Myotis daubentonii (Daubenton's bat): 132220859 Help Entry 132220859         CDS       T10294                                  Name (RefSeq) histone H2B type 1-B   KO K11252   histone H2B Organism mdt  Myotis daubentonii (Daubenton's bat) Pathway mdt04613   Neutrophil extracellular trap formation mdt05034   Alcoholism mdt05203   Viral carcinogenesis mdt05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mdt00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     132220859  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     132220859   09163 Immune disease    05322 Systemic lupus erythematosus     132220859   09165 Substance dependence    05034 Alcoholism     132220859  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mdt03036]     132220859   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mdt04147]     132220859 Chromosome and associated proteins [BR:mdt03036]  Eukaryotic type   Nucleosome assembly factors    Histones     132220859 Exosome [BR:mdt04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    132220859 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  132220859 NCBI-ProteinID:  XP_059530497 LinkDB All DBs Position 18:complement(43642079..43642594) Genome browser AA seq 126 aa AA seqDB search MPEPSKSAPAPKKGSKKAITKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgccggaaccttccaaatcggcgcccgccccaaagaagggctccaagaaagccatcacc aaggctcagaagaaagatggcaagaagcgcaagcgcagccgcaaggagagctattccatc tacgtgtacaaggtgctcaagcaggtgcaccccgacaccggcatctcgtccaaggccatg ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc ctggcgcattacaacaagcgctcgaccatcacgtcgcgcgagatccagacggccgtgcgc ctgctgctgcccggcgagctggccaaacacgccgtgtccgagggcaccaaggccgtcacc aagtacaccagctccaagtga

DBGET integrated database retrieval system