Myotis daubentonii (Daubenton's bat): 132221210 Help Entry 132221210         CDS       T10294                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism mdt  Myotis daubentonii (Daubenton's bat) Pathway mdt01521   EGFR tyrosine kinase inhibitor resistance mdt01522   Endocrine resistance mdt04010   MAPK signaling pathway mdt04012   ErbB signaling pathway mdt04014   Ras signaling pathway mdt04015   Rap1 signaling pathway mdt04062   Chemokine signaling pathway mdt04068   FoxO signaling pathway mdt04071   Sphingolipid signaling pathway mdt04072   Phospholipase D signaling pathway mdt04137   Mitophagy - animal mdt04140   Autophagy - animal mdt04150   mTOR signaling pathway mdt04151   PI3K-Akt signaling pathway mdt04210   Apoptosis mdt04211   Longevity regulating pathway mdt04213   Longevity regulating pathway - multiple species mdt04218   Cellular senescence mdt04360   Axon guidance mdt04370   VEGF signaling pathway mdt04371   Apelin signaling pathway mdt04540   Gap junction mdt04550   Signaling pathways regulating pluripotency of stem cells mdt04625   C-type lectin receptor signaling pathway mdt04650   Natural killer cell mediated cytotoxicity mdt04660   T cell receptor signaling pathway mdt04662   B cell receptor signaling pathway mdt04664   Fc epsilon RI signaling pathway mdt04714   Thermogenesis mdt04720   Long-term potentiation mdt04722   Neurotrophin signaling pathway mdt04725   Cholinergic synapse mdt04726   Serotonergic synapse mdt04730   Long-term depression mdt04810   Regulation of actin cytoskeleton mdt04910   Insulin signaling pathway mdt04912   GnRH signaling pathway mdt04915   Estrogen signaling pathway mdt04916   Melanogenesis mdt04917   Prolactin signaling pathway mdt04919   Thyroid hormone signaling pathway mdt04921   Oxytocin signaling pathway mdt04926   Relaxin signaling pathway mdt04929   GnRH secretion mdt04933   AGE-RAGE signaling pathway in diabetic complications mdt04935   Growth hormone synthesis, secretion and action mdt05010   Alzheimer disease mdt05022   Pathways of neurodegeneration - multiple diseases mdt05034   Alcoholism mdt05160   Hepatitis C mdt05161   Hepatitis B mdt05163   Human cytomegalovirus infection mdt05165   Human papillomavirus infection mdt05166   Human T-cell leukemia virus 1 infection mdt05167   Kaposi sarcoma-associated herpesvirus infection mdt05170   Human immunodeficiency virus 1 infection mdt05200   Pathways in cancer mdt05203   Viral carcinogenesis mdt05205   Proteoglycans in cancer mdt05206   MicroRNAs in cancer mdt05207   Chemical carcinogenesis - receptor activation mdt05208   Chemical carcinogenesis - reactive oxygen species mdt05210   Colorectal cancer mdt05211   Renal cell carcinoma mdt05213   Endometrial cancer mdt05214   Glioma mdt05215   Prostate cancer mdt05216   Thyroid cancer mdt05218   Melanoma mdt05219   Bladder cancer mdt05220   Chronic myeloid leukemia mdt05221   Acute myeloid leukemia mdt05223   Non-small cell lung cancer mdt05224   Breast cancer mdt05225   Hepatocellular carcinoma mdt05226   Gastric cancer mdt05230   Central carbon metabolism in cancer mdt05231   Choline metabolism in cancer mdt05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mdt05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mdt00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     132221210 (NRAS)    04012 ErbB signaling pathway     132221210 (NRAS)    04014 Ras signaling pathway     132221210 (NRAS)    04015 Rap1 signaling pathway     132221210 (NRAS)    04370 VEGF signaling pathway     132221210 (NRAS)    04371 Apelin signaling pathway     132221210 (NRAS)    04068 FoxO signaling pathway     132221210 (NRAS)    04072 Phospholipase D signaling pathway     132221210 (NRAS)    04071 Sphingolipid signaling pathway     132221210 (NRAS)    04151 PI3K-Akt signaling pathway     132221210 (NRAS)    04150 mTOR signaling pathway     132221210 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     132221210 (NRAS)    04137 Mitophagy - animal     132221210 (NRAS)   09143 Cell growth and death    04210 Apoptosis     132221210 (NRAS)    04218 Cellular senescence     132221210 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     132221210 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     132221210 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     132221210 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     132221210 (NRAS)    04650 Natural killer cell mediated cytotoxicity     132221210 (NRAS)    04660 T cell receptor signaling pathway     132221210 (NRAS)    04662 B cell receptor signaling pathway     132221210 (NRAS)    04664 Fc epsilon RI signaling pathway     132221210 (NRAS)    04062 Chemokine signaling pathway     132221210 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     132221210 (NRAS)    04929 GnRH secretion     132221210 (NRAS)    04912 GnRH signaling pathway     132221210 (NRAS)    04915 Estrogen signaling pathway     132221210 (NRAS)    04917 Prolactin signaling pathway     132221210 (NRAS)    04921 Oxytocin signaling pathway     132221210 (NRAS)    04926 Relaxin signaling pathway     132221210 (NRAS)    04935 Growth hormone synthesis, secretion and action     132221210 (NRAS)    04919 Thyroid hormone signaling pathway     132221210 (NRAS)    04916 Melanogenesis     132221210 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     132221210 (NRAS)    04726 Serotonergic synapse     132221210 (NRAS)    04720 Long-term potentiation     132221210 (NRAS)    04730 Long-term depression     132221210 (NRAS)    04722 Neurotrophin signaling pathway     132221210 (NRAS)   09158 Development and regeneration    04360 Axon guidance     132221210 (NRAS)   09149 Aging    04211 Longevity regulating pathway     132221210 (NRAS)    04213 Longevity regulating pathway - multiple species     132221210 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     132221210 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     132221210 (NRAS)    05206 MicroRNAs in cancer     132221210 (NRAS)    05205 Proteoglycans in cancer     132221210 (NRAS)    05207 Chemical carcinogenesis - receptor activation     132221210 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     132221210 (NRAS)    05203 Viral carcinogenesis     132221210 (NRAS)    05230 Central carbon metabolism in cancer     132221210 (NRAS)    05231 Choline metabolism in cancer     132221210 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     132221210 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     132221210 (NRAS)    05225 Hepatocellular carcinoma     132221210 (NRAS)    05226 Gastric cancer     132221210 (NRAS)    05214 Glioma     132221210 (NRAS)    05216 Thyroid cancer     132221210 (NRAS)    05221 Acute myeloid leukemia     132221210 (NRAS)    05220 Chronic myeloid leukemia     132221210 (NRAS)    05218 Melanoma     132221210 (NRAS)    05211 Renal cell carcinoma     132221210 (NRAS)    05219 Bladder cancer     132221210 (NRAS)    05215 Prostate cancer     132221210 (NRAS)    05213 Endometrial cancer     132221210 (NRAS)    05224 Breast cancer     132221210 (NRAS)    05223 Non-small cell lung cancer     132221210 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     132221210 (NRAS)    05170 Human immunodeficiency virus 1 infection     132221210 (NRAS)    05161 Hepatitis B     132221210 (NRAS)    05160 Hepatitis C     132221210 (NRAS)    05163 Human cytomegalovirus infection     132221210 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     132221210 (NRAS)    05165 Human papillomavirus infection     132221210 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     132221210 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     132221210 (NRAS)   09165 Substance dependence    05034 Alcoholism     132221210 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     132221210 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     132221210 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     132221210 (NRAS)    01522 Endocrine resistance     132221210 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mdt04131]     132221210 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mdt04147]     132221210 (NRAS)    04031 GTP-binding proteins [BR:mdt04031]     132221210 (NRAS) Membrane trafficking [BR:mdt04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     132221210 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     132221210 (NRAS) Exosome [BR:mdt04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    132221210 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    132221210 (NRAS)   Exosomal proteins of breast cancer cells    132221210 (NRAS)   Exosomal proteins of colorectal cancer cells    132221210 (NRAS) GTP-binding proteins [BR:mdt04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     132221210 (NRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  132221210 NCBI-ProteinID:  XP_059531242 LinkDB All DBs Position 18:35789781..35800307 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcgctgaca atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac cgaaaacaggtggttatagatggtgaaacctgtctattggatatactggatacagctgga caagaggagtacagtgctatgagggaccaatacatgaggacaggggaaggcttcctctgt gtattcgccatcaataatagcaagtcatttgcagatattaacctctacagggaacagatt aagcgagtgaaggactcagatgatgtacctatggtgctagtaggaaacaagtgtgatttg ccaacaaggacagttgacacaaaacaagcccatgaactggccaagagttatgggattcca ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactagta agagaaatacgtcagtaccgaatgaaaaaactcaacagcagtgatgatgggactcaaggt tgcatggggttgccttgtgtggtgatgtaa

DBGET integrated database retrieval system