KEGG   Myotis daubentonii (Daubenton's bat): 132222289
Entry
132222289         CDS       T10294                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
mdt  Myotis daubentonii (Daubenton's bat)
Pathway
mdt01521  EGFR tyrosine kinase inhibitor resistance
mdt01522  Endocrine resistance
mdt01524  Platinum drug resistance
mdt04010  MAPK signaling pathway
mdt04012  ErbB signaling pathway
mdt04014  Ras signaling pathway
mdt04015  Rap1 signaling pathway
mdt04022  cGMP-PKG signaling pathway
mdt04024  cAMP signaling pathway
mdt04062  Chemokine signaling pathway
mdt04066  HIF-1 signaling pathway
mdt04068  FoxO signaling pathway
mdt04071  Sphingolipid signaling pathway
mdt04072  Phospholipase D signaling pathway
mdt04114  Oocyte meiosis
mdt04140  Autophagy - animal
mdt04148  Efferocytosis
mdt04150  mTOR signaling pathway
mdt04151  PI3K-Akt signaling pathway
mdt04210  Apoptosis
mdt04218  Cellular senescence
mdt04261  Adrenergic signaling in cardiomyocytes
mdt04270  Vascular smooth muscle contraction
mdt04350  TGF-beta signaling pathway
mdt04360  Axon guidance
mdt04370  VEGF signaling pathway
mdt04371  Apelin signaling pathway
mdt04380  Osteoclast differentiation
mdt04510  Focal adhesion
mdt04520  Adherens junction
mdt04540  Gap junction
mdt04550  Signaling pathways regulating pluripotency of stem cells
mdt04611  Platelet activation
mdt04613  Neutrophil extracellular trap formation
mdt04620  Toll-like receptor signaling pathway
mdt04621  NOD-like receptor signaling pathway
mdt04625  C-type lectin receptor signaling pathway
mdt04650  Natural killer cell mediated cytotoxicity
mdt04657  IL-17 signaling pathway
mdt04658  Th1 and Th2 cell differentiation
mdt04659  Th17 cell differentiation
mdt04660  T cell receptor signaling pathway
mdt04662  B cell receptor signaling pathway
mdt04664  Fc epsilon RI signaling pathway
mdt04666  Fc gamma R-mediated phagocytosis
mdt04668  TNF signaling pathway
mdt04713  Circadian entrainment
mdt04720  Long-term potentiation
mdt04722  Neurotrophin signaling pathway
mdt04723  Retrograde endocannabinoid signaling
mdt04724  Glutamatergic synapse
mdt04725  Cholinergic synapse
mdt04726  Serotonergic synapse
mdt04730  Long-term depression
mdt04810  Regulation of actin cytoskeleton
mdt04910  Insulin signaling pathway
mdt04912  GnRH signaling pathway
mdt04914  Progesterone-mediated oocyte maturation
mdt04915  Estrogen signaling pathway
mdt04916  Melanogenesis
mdt04917  Prolactin signaling pathway
mdt04919  Thyroid hormone signaling pathway
mdt04921  Oxytocin signaling pathway
mdt04926  Relaxin signaling pathway
mdt04928  Parathyroid hormone synthesis, secretion and action
mdt04929  GnRH secretion
mdt04930  Type II diabetes mellitus
mdt04933  AGE-RAGE signaling pathway in diabetic complications
mdt04934  Cushing syndrome
mdt04935  Growth hormone synthesis, secretion and action
mdt04960  Aldosterone-regulated sodium reabsorption
mdt05010  Alzheimer disease
mdt05020  Prion disease
mdt05022  Pathways of neurodegeneration - multiple diseases
mdt05034  Alcoholism
mdt05132  Salmonella infection
mdt05133  Pertussis
mdt05135  Yersinia infection
mdt05140  Leishmaniasis
mdt05142  Chagas disease
mdt05145  Toxoplasmosis
mdt05152  Tuberculosis
mdt05160  Hepatitis C
mdt05161  Hepatitis B
mdt05163  Human cytomegalovirus infection
mdt05164  Influenza A
mdt05165  Human papillomavirus infection
mdt05166  Human T-cell leukemia virus 1 infection
mdt05167  Kaposi sarcoma-associated herpesvirus infection
mdt05170  Human immunodeficiency virus 1 infection
mdt05171  Coronavirus disease - COVID-19
mdt05200  Pathways in cancer
mdt05203  Viral carcinogenesis
mdt05205  Proteoglycans in cancer
mdt05206  MicroRNAs in cancer
mdt05207  Chemical carcinogenesis - receptor activation
mdt05208  Chemical carcinogenesis - reactive oxygen species
mdt05210  Colorectal cancer
mdt05211  Renal cell carcinoma
mdt05212  Pancreatic cancer
mdt05213  Endometrial cancer
mdt05214  Glioma
mdt05215  Prostate cancer
mdt05216  Thyroid cancer
mdt05218  Melanoma
mdt05219  Bladder cancer
mdt05220  Chronic myeloid leukemia
mdt05221  Acute myeloid leukemia
mdt05223  Non-small cell lung cancer
mdt05224  Breast cancer
mdt05225  Hepatocellular carcinoma
mdt05226  Gastric cancer
mdt05230  Central carbon metabolism in cancer
mdt05231  Choline metabolism in cancer
mdt05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mdt05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mdt00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    132222289 (MAPK1)
   04012 ErbB signaling pathway
    132222289 (MAPK1)
   04014 Ras signaling pathway
    132222289 (MAPK1)
   04015 Rap1 signaling pathway
    132222289 (MAPK1)
   04350 TGF-beta signaling pathway
    132222289 (MAPK1)
   04370 VEGF signaling pathway
    132222289 (MAPK1)
   04371 Apelin signaling pathway
    132222289 (MAPK1)
   04668 TNF signaling pathway
    132222289 (MAPK1)
   04066 HIF-1 signaling pathway
    132222289 (MAPK1)
   04068 FoxO signaling pathway
    132222289 (MAPK1)
   04072 Phospholipase D signaling pathway
    132222289 (MAPK1)
   04071 Sphingolipid signaling pathway
    132222289 (MAPK1)
   04024 cAMP signaling pathway
    132222289 (MAPK1)
   04022 cGMP-PKG signaling pathway
    132222289 (MAPK1)
   04151 PI3K-Akt signaling pathway
    132222289 (MAPK1)
   04150 mTOR signaling pathway
    132222289 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    132222289 (MAPK1)
   04148 Efferocytosis
    132222289 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    132222289 (MAPK1)
   04210 Apoptosis
    132222289 (MAPK1)
   04218 Cellular senescence
    132222289 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    132222289 (MAPK1)
   04520 Adherens junction
    132222289 (MAPK1)
   04540 Gap junction
    132222289 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    132222289 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    132222289 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    132222289 (MAPK1)
   04613 Neutrophil extracellular trap formation
    132222289 (MAPK1)
   04620 Toll-like receptor signaling pathway
    132222289 (MAPK1)
   04621 NOD-like receptor signaling pathway
    132222289 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    132222289 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    132222289 (MAPK1)
   04660 T cell receptor signaling pathway
    132222289 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    132222289 (MAPK1)
   04659 Th17 cell differentiation
    132222289 (MAPK1)
   04657 IL-17 signaling pathway
    132222289 (MAPK1)
   04662 B cell receptor signaling pathway
    132222289 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    132222289 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    132222289 (MAPK1)
   04062 Chemokine signaling pathway
    132222289 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    132222289 (MAPK1)
   04929 GnRH secretion
    132222289 (MAPK1)
   04912 GnRH signaling pathway
    132222289 (MAPK1)
   04915 Estrogen signaling pathway
    132222289 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    132222289 (MAPK1)
   04917 Prolactin signaling pathway
    132222289 (MAPK1)
   04921 Oxytocin signaling pathway
    132222289 (MAPK1)
   04926 Relaxin signaling pathway
    132222289 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    132222289 (MAPK1)
   04919 Thyroid hormone signaling pathway
    132222289 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    132222289 (MAPK1)
   04916 Melanogenesis
    132222289 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    132222289 (MAPK1)
   04270 Vascular smooth muscle contraction
    132222289 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    132222289 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    132222289 (MAPK1)
   04725 Cholinergic synapse
    132222289 (MAPK1)
   04726 Serotonergic synapse
    132222289 (MAPK1)
   04720 Long-term potentiation
    132222289 (MAPK1)
   04730 Long-term depression
    132222289 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    132222289 (MAPK1)
   04722 Neurotrophin signaling pathway
    132222289 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    132222289 (MAPK1)
   04380 Osteoclast differentiation
    132222289 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    132222289 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    132222289 (MAPK1)
   05206 MicroRNAs in cancer
    132222289 (MAPK1)
   05205 Proteoglycans in cancer
    132222289 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    132222289 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    132222289 (MAPK1)
   05203 Viral carcinogenesis
    132222289 (MAPK1)
   05230 Central carbon metabolism in cancer
    132222289 (MAPK1)
   05231 Choline metabolism in cancer
    132222289 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    132222289 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    132222289 (MAPK1)
   05212 Pancreatic cancer
    132222289 (MAPK1)
   05225 Hepatocellular carcinoma
    132222289 (MAPK1)
   05226 Gastric cancer
    132222289 (MAPK1)
   05214 Glioma
    132222289 (MAPK1)
   05216 Thyroid cancer
    132222289 (MAPK1)
   05221 Acute myeloid leukemia
    132222289 (MAPK1)
   05220 Chronic myeloid leukemia
    132222289 (MAPK1)
   05218 Melanoma
    132222289 (MAPK1)
   05211 Renal cell carcinoma
    132222289 (MAPK1)
   05219 Bladder cancer
    132222289 (MAPK1)
   05215 Prostate cancer
    132222289 (MAPK1)
   05213 Endometrial cancer
    132222289 (MAPK1)
   05224 Breast cancer
    132222289 (MAPK1)
   05223 Non-small cell lung cancer
    132222289 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    132222289 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    132222289 (MAPK1)
   05161 Hepatitis B
    132222289 (MAPK1)
   05160 Hepatitis C
    132222289 (MAPK1)
   05171 Coronavirus disease - COVID-19
    132222289 (MAPK1)
   05164 Influenza A
    132222289 (MAPK1)
   05163 Human cytomegalovirus infection
    132222289 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    132222289 (MAPK1)
   05165 Human papillomavirus infection
    132222289 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    132222289 (MAPK1)
   05135 Yersinia infection
    132222289 (MAPK1)
   05133 Pertussis
    132222289 (MAPK1)
   05152 Tuberculosis
    132222289 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    132222289 (MAPK1)
   05140 Leishmaniasis
    132222289 (MAPK1)
   05142 Chagas disease
    132222289 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    132222289 (MAPK1)
   05020 Prion disease
    132222289 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    132222289 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    132222289 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    132222289 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    132222289 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    132222289 (MAPK1)
   04934 Cushing syndrome
    132222289 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    132222289 (MAPK1)
   01524 Platinum drug resistance
    132222289 (MAPK1)
   01522 Endocrine resistance
    132222289 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mdt01001]
    132222289 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mdt03036]
    132222289 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mdt04147]
    132222289 (MAPK1)
Enzymes [BR:mdt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     132222289 (MAPK1)
Protein kinases [BR:mdt01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   132222289 (MAPK1)
Chromosome and associated proteins [BR:mdt03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     132222289 (MAPK1)
Exosome [BR:mdt04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   132222289 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH STATB_N Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 132222289
NCBI-ProteinID: XP_059533166
LinkDB
Position
19:13455002..13534796
AA seq 359 aa
MAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEH
QTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHL
SNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHT
GFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHIL
GILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKR
IEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcgggcgcgggcccggagatggtccgcgggcaggtgttcgacgtg
gggccgcgctacaccaacctctcgtacattggcgagggcgcctacggcatggtgtgctct
gcttatgataatgtcaacaaagttcgagtagctatcaagaaaatcagtccttttgagcac
cagacctactgccagagaaccctgagggagataaaaatcctactgcgcttcagacacgag
aacatcattggaatcaatgatattattcgagcgccaaccatcgagcaaatgaaagatgta
tatatagtacaggacctcatggaaacagatctctacaagctcttgaagacacaacacctc
agcaacgaccatatctgctattttctttaccagatcctcagagggttaaaatatatccat
tcagctaatgtactgcaccgtgacctcaaaccttccaacctgctgctcaacaccacctgt
gatctcaagatctgtgattttggcttggcccgcgttgcagatccagaccatgatcacaca
gggttcctgacagagtatgtagccacacgttggtacagggctccagaaattatgttgaat
tccaagggctataccaagtccattgatatttggtctgtaggctgcattctggcagagatg
ctctccaacaggcccatcttcccagggaagcattaccttgaccagctgaaccacattctg
ggtattcttggatccccatcacaggaagacctgaactgcataatcaacctaaaagctaga
aactatttgctttctctcccacacaaaaataaggtgccatggaacaggctgttcccaaat
gctgattccaaagctctggatttactggacaaaatgttgaccttcaaccctcacaagagg
attgaagtagaacaggcgctagcccacccgtatctggagcagtattatgacccaagtgat
gagcccattgctgaagcaccattcaagtttgacatggaattggatgacttgcctaaggag
aagctcaaagaactcatttttgaagagaccgctagattccagcctggatatagatcttaa

DBGET integrated database retrieval system