Myotis daubentonii (Daubenton's bat): 132222365 Help Entry 132222365         CDS       T10294                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism mdt  Myotis daubentonii (Daubenton's bat) Pathway mdt04613   Neutrophil extracellular trap formation mdt05034   Alcoholism mdt05202   Transcriptional misregulation in cancer mdt05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mdt00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     132222365  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     132222365   09163 Immune disease    05322 Systemic lupus erythematosus     132222365   09165 Substance dependence    05034 Alcoholism     132222365  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mdt03036]     132222365   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mdt04147]     132222365 Chromosome and associated proteins [BR:mdt03036]  Eukaryotic type   Nucleosome assembly factors    Histones     132222365 Exosome [BR:mdt04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    132222365 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-S CENP-T_C PAF CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  132222365 NCBI-ProteinID:  XP_059533243 LinkDB All DBs Position 20:14629896..14630474 Genome browser AA seq 136 aa AA seqDB search MTRTKPTARKSAGGKAPRKQLATEAARKSAPSTGEVMRPHRYWPGIVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLSFQSAAIGALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIRLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atgacccgaaccaagccgactgctcgcaaatccgcgggtgggaaagcgccccgcaaacag ctggccactgaagccgccaggaaaagcgccccctccaccggcgaggtgatgaggccccat cgctactggcccgggatcgttgcgcttcgagaaatccgccgttaccagaaatcgaccgag cttctgatccggaagctgcctttccagaggttggtgagggagatcgcccaggatttcaaa actgacctgagttttcaaagtgcagccatcggtgcgctgcaggaggcctgcgaggcgtac ctggtgggtttatttgaagatacgaatctgtgtgccatccacgctaagagagtcaccatc atgcccaaagacatccggttggctcgccggatacggggagagagagcctaa

DBGET integrated database retrieval system