Myotis daubentonii (Daubenton's bat): 132228097 Help Entry 132228097         CDS       T10294                                  Name (RefSeq) polyubiquitin-like   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism mdt  Myotis daubentonii (Daubenton's bat) Pathway mdt03010   Ribosome mdt04120   Ubiquitin mediated proteolysis mdt04137   Mitophagy - animal mdt04140   Autophagy - animal mdt05012   Parkinson disease mdt05022   Pathways of neurodegeneration - multiple diseases mdt05167   Kaposi sarcoma-associated herpesvirus infection mdt05171   Coronavirus disease - COVID-19 Brite KEGG Orthology (KO) [BR:mdt00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     132228097   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     132228097  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     132228097    04137 Mitophagy - animal     132228097  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     132228097    05167 Kaposi sarcoma-associated herpesvirus infection     132228097   09164 Neurodegenerative disease    05012 Parkinson disease     132228097    05022 Pathways of neurodegeneration - multiple diseases     132228097  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mdt03011]     132228097    04121 Ubiquitin system [BR:mdt04121]     132228097 Ribosome [BR:mdt03011]  Ribosomal proteins   Eukaryotes    Large subunit     132228097   Archaea     132228097 Ubiquitin system [BR:mdt04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    132228097 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 OTU1_UBXL Plexin_RBD RLMM_N Motif Other DBs NCBI-GeneID:  132228097 NCBI-ProteinID:  XP_059539953 LinkDB All DBs Position 2:complement(99038031..99038372) Genome browser AA seq 69 aa AA seqDB search MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQLEDRRTLSNYNIQKESTLH LVLRLRGGV NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgcagatcttcgtgaaaaccttgaccggcaagaccatcaccctcgaggtcgagcccagt gacaccatcgagaatgtcaaggccaagatccaagacaaagagggcatcccccctgaccag cagctggaagacaggcgcaccctgtccaactacaacatccagaaagagtccactctgcac ctggtcctgcgcttgagagggggtgtctaa

DBGET integrated database retrieval system