Myotis daubentonii (Daubenton's bat): 132229780 Help Entry 132229780         CDS       T10294                                  Name (RefSeq) claudin-7-like   KO K06087   claudin Organism mdt  Myotis daubentonii (Daubenton's bat) Pathway mdt03272   Virion - Hepatitis viruses mdt04382   Cornified envelope formation mdt04514   Cell adhesion molecules mdt04530   Tight junction mdt04670   Leukocyte transendothelial migration mdt05160   Hepatitis C Brite KEGG Orthology (KO) [BR:mdt00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     132229780  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     132229780  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     132229780  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     132229780   09158 Development and regeneration    04382 Cornified envelope formation     132229780  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     132229780  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:mdt03037]     132229780    04147 Exosome [BR:mdt04147]     132229780    04515 Cell adhesion molecules [BR:mdt04515]     132229780 Cilium and associated proteins [BR:mdt03037]  Other cilia and associated proteins   Stereociliary proteins    132229780 Exosome [BR:mdt04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    132229780   Exosomal proteins of colorectal cancer cells    132229780 Cell adhesion molecules [BR:mdt04515]  Immunoglobulin superfamily   L1 family    132229780 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 OppC_N Motif Other DBs NCBI-GeneID:  132229780 NCBI-ProteinID:  XP_059542222 LinkDB All DBs Position 3:complement(194195022..194195867) Genome browser AA seq 140 aa AA seqDB search MVVPLVLGFMAMFVATMDMKCTRCGGDDKVKKARIAMTGGTIFIVAGLAALIACSWYDHK IITGFYNPLVPMNTKDEVGPAVFIGWAGPALVLLGGAMLSCSCPESEGKARYGAPRSYSK PSSAKAPTLLTLEDSGTWFP NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggtggtgcccctcgtgctgggcttcatggccatgttcgtggccacgatggacatgaag tgcacacgctgtgggggagacgacaaagtgaaaaaggcccgtatagccatgaccggaggc accattttcatcgtggccggtctggctgctttgatagcttgctcctggtacgaccataag atcatcacaggcttttataaccctttggtccccatgaatactaaggacgaggttggtcct gccgtcttcatcggctgggcagggcctgctctggtcctcttgggaggtgcaatgctctct tgctcctgccctgagagtgagggcaaagctaggtatggtgcgccccgctcctactctaag ccgagctctgccaaggccccaacactgctgactcttgaagactcaggtacttggtttcct taa

DBGET integrated database retrieval system