Myotis daubentonii (Daubenton's bat): 132231480 Help Entry 132231480         CDS       T10294                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism mdt  Myotis daubentonii (Daubenton's bat) Brite KEGG Orthology (KO) [BR:mdt00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:mdt03041]     132231480   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mdt04052]     132231480 Spliceosome [BR:mdt03041]  Complex B   Other components    Complex B specific factors     132231480 Cytokines and neuropeptides [BR:mdt04052]  Neuropeptides   Unclassified    132231480 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Motif Other DBs NCBI-GeneID:  132231480 NCBI-ProteinID:  XP_059546651 LinkDB All DBs Position 3:203261174..203263172 Genome browser AA seq 73 aa AA seqDB search MIEVVCNDRLGKKARVKCNTDDTIGDLKKLIPAQTGTRGNKIVLKKWYTIFKDHVSLSDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatagaggtggtttgcaacgaccgtctggggaagaaggcccgagtgaagtgcaacacc gatgacaccatcggggacctgaagaagctgatccccgcccagacggggacccgtgggaat aagattgtgctgaagaagtggtacacgatctttaaggaccacgtttctctgagcgactat gaaatccatgatgggatgaacctggaactttattaccaataa

DBGET integrated database retrieval system