Myotis daubentonii (Daubenton's bat): 132234313 Help Entry 132234313         CDS       T10294                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism mdt  Myotis daubentonii (Daubenton's bat) Pathway mdt04015   Rap1 signaling pathway mdt04810   Regulation of actin cytoskeleton mdt05014   Amyotrophic lateral sclerosis mdt05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mdt00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     132234313 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     132234313 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     132234313 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     132234313 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mdt04131]     132234313 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mdt04812]     132234313 (PFN3)    04147 Exosome [BR:mdt04147]     132234313 (PFN3) Membrane trafficking [BR:mdt04131]  Others   Actin-binding proteins    Others     132234313 (PFN3) Cytoskeleton proteins [BR:mdt04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      132234313 (PFN3) Exosome [BR:mdt04147]  Exosomal proteins   Proteins found in most exosomes    132234313 (PFN3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  132234313 NCBI-ProteinID:  XP_059551311 LinkDB All DBs Position 5:73376978..73377782 Genome browser AA seq 137 aa AA seqDB search MGEWKAYISAVLQDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGQDRCTFL QAGLSVAGRRCCVIRDHLLAEGDGVLDARTKGLDGRAVCVGHTPRALLVLMGRRGVHGGI LNKKVHELIHWLRTQGT NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggcgagtggaaagcctacatcagtgcggtgctgcaggaccagcgcatcgacgacgta gccatcgtgggccactcggacaatcgctgtgtgtgggcatcgcggcccgggggactgctg gccgccatctcgccgcaggaggtgggtgtgctcacggggcaggaccggtgcaccttcctg caggccggcctgagcgtggcgggccgccgctgctgcgtcatcagagaccacctgctggcg gagggcgacggcgtgctggacgcgcgcaccaaggggctggatgggcgcgcggtctgcgtg ggccacacgccgcgcgctcttctcgtgctcatgggccggcggggcgtgcacgggggcatc ctcaacaagaaggtgcacgagctgatccactggctgcgcactcagggcacctag

DBGET integrated database retrieval system