Myotis daubentonii (Daubenton's bat): 132238352 Help Entry 132238352         CDS       T10294                                  Symbol NPPC Name (RefSeq) C-type natriuretic peptide   KO K12336   natriuretic peptide C Organism mdt  Myotis daubentonii (Daubenton's bat) Pathway mdt04022   cGMP-PKG signaling pathway mdt04081   Hormone signaling mdt04270   Vascular smooth muscle contraction mdt05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mdt00001]  09130 Environmental Information Processing   09132 Signal transduction    04022 cGMP-PKG signaling pathway     132238352 (NPPC)   09133 Signaling molecules and interaction    04081 Hormone signaling     132238352 (NPPC)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     132238352 (NPPC)  09160 Human Diseases   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     132238352 (NPPC)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mdt04052]     132238352 (NPPC) Cytokines and neuropeptides [BR:mdt04052]  Neuropeptides   Unclassified    132238352 (NPPC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  132238352 NCBI-ProteinID:  XP_059559508 LinkDB All DBs Position 7:complement(31852387..31857547) Genome browser AA seq 103 aa AA seqDB search MHLSQLLACALLLTLLSLWQSEAKPGVLSKGPRTPLGEVAAASQAESGGQKKRGAINLGG NRPRVFQDTKTRWSRLRRKYPSPGNNCFGHKLDRIGAHSGLGC NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgcacctctcccaactgctggcctgcgccctgctgctcaccctactctcgctctggcaa tccgaagccaagcccggtgtgctatcgaagggcccgcgaactccgctaggggaggtggca gccgcgtcccaggctgagagcggcggtcagaagaagcgcggtgccatcaacctcgggggc aaccggccgcgagtgttccaggacaccaagactcgatggtcccgccttcgcagaaaatac ccgagtccgggcaataactgcttcggccataagctggaccggatcggcgcccatagtggc ctaggatgttag

DBGET integrated database retrieval system