Myotis daubentonii (Daubenton's bat): 132239491 Help Entry 132239491         CDS       T10294                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism mdt  Myotis daubentonii (Daubenton's bat) Pathway mdt01521   EGFR tyrosine kinase inhibitor resistance mdt01524   Platinum drug resistance mdt04014   Ras signaling pathway mdt04064   NF-kappa B signaling pathway mdt04115   p53 signaling pathway mdt04137   Mitophagy - animal mdt04140   Autophagy - animal mdt04151   PI3K-Akt signaling pathway mdt04210   Apoptosis mdt04215   Apoptosis - multiple species mdt04621   NOD-like receptor signaling pathway mdt04630   JAK-STAT signaling pathway mdt05012   Parkinson disease mdt05014   Amyotrophic lateral sclerosis mdt05022   Pathways of neurodegeneration - multiple diseases mdt05145   Toxoplasmosis mdt05162   Measles mdt05166   Human T-cell leukemia virus 1 infection mdt05168   Herpes simplex virus 1 infection mdt05170   Human immunodeficiency virus 1 infection mdt05200   Pathways in cancer mdt05202   Transcriptional misregulation in cancer mdt05212   Pancreatic cancer mdt05220   Chronic myeloid leukemia mdt05222   Small cell lung cancer mdt05225   Hepatocellular carcinoma mdt05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mdt00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     132239491 (BCL2L1)    04630 JAK-STAT signaling pathway     132239491 (BCL2L1)    04064 NF-kappa B signaling pathway     132239491 (BCL2L1)    04151 PI3K-Akt signaling pathway     132239491 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     132239491 (BCL2L1)    04137 Mitophagy - animal     132239491 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     132239491 (BCL2L1)    04215 Apoptosis - multiple species     132239491 (BCL2L1)    04115 p53 signaling pathway     132239491 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     132239491 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     132239491 (BCL2L1)    05202 Transcriptional misregulation in cancer     132239491 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     132239491 (BCL2L1)    05225 Hepatocellular carcinoma     132239491 (BCL2L1)    05220 Chronic myeloid leukemia     132239491 (BCL2L1)    05222 Small cell lung cancer     132239491 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     132239491 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     132239491 (BCL2L1)    05162 Measles     132239491 (BCL2L1)    05168 Herpes simplex virus 1 infection     132239491 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     132239491 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     132239491 (BCL2L1)    05014 Amyotrophic lateral sclerosis     132239491 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     132239491 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     132239491 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     132239491 (BCL2L1)    01524 Platinum drug resistance     132239491 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mdt01009]     132239491 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mdt03036]     132239491 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:mdt02000]     132239491 (BCL2L1) Protein phosphatases and associated proteins [BR:mdt01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      132239491 (BCL2L1) Chromosome and associated proteins [BR:mdt03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     132239491 (BCL2L1) Transporters [BR:mdt02000]  Other transporters   Pores ion channels [TC:1]    132239491 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  132239491 NCBI-ProteinID:  XP_059561816 LinkDB All DBs Position 8:complement(34195164..34241290) Genome browser AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEVETPSAINGNPSWHLV DSPVVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggaactggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagttcagtgatgtggaagagaacagaactgaggccccagaaggg actgaatcagaggtggagacccccagtgccatcaatggcaacccatcctggcacctggtg gacagccctgtggtgaatggagccactggccacagcagcagcttggatgcccgggaggtg attcccatggcagccgtgaagcaagcgctgagggaggcaggcgatgagtttgaactgcgg taccggcgggcgttcagcgacctgacatcccagctccacatcaccccggggacagcatat cagagctttgagcaagtagtgaatgaactcttccgggatggggtgaactggggtcgcatt gtggcctttttctcgtttggtggggcgttgtgcgtggaaagtgtggacaaggagatgcag gtattggtgagtcggattgcaacgtggatggccacttacctgaatgaccacctagagcct tggatccaggagaacggaggctgggacacctttgtggaactctacgggaacaacgcagca gccgagagccggaagggccaggaacgcttcaatcgctggttcctgacgggcatgactgtg gctggcgtggttctgctgggctcactcttcagtcggaaatga

DBGET integrated database retrieval system