Myotis daubentonii (Daubenton's bat): 132241401 Help Entry 132241401         CDS       T10294                                  Symbol CFL1 Name (RefSeq) cofilin-1   KO K05765   cofilin Organism mdt  Myotis daubentonii (Daubenton's bat) Pathway mdt04360   Axon guidance mdt04666   Fc gamma R-mediated phagocytosis mdt04810   Regulation of actin cytoskeleton mdt05133   Pertussis mdt05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:mdt00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     132241401 (CFL1)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     132241401 (CFL1)   09158 Development and regeneration    04360 Axon guidance     132241401 (CFL1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     132241401 (CFL1)   09171 Infectious disease: bacterial    05133 Pertussis     132241401 (CFL1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mdt04131]     132241401 (CFL1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mdt04812]     132241401 (CFL1)    04147 Exosome [BR:mdt04147]     132241401 (CFL1) Membrane trafficking [BR:mdt04131]  Others   Actin-binding proteins    Others     132241401 (CFL1) Cytoskeleton proteins [BR:mdt04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      132241401 (CFL1) Exosome [BR:mdt04147]  Exosomal proteins   Proteins found in most exosomes    132241401 (CFL1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  132241401 NCBI-ProteinID:  XP_059566040 LinkDB All DBs Position 9:80813508..80816974 Genome browser AA seq 166 aa AA seqDB search MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDV GQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS KDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atggcctctggtgtggctgtctctgatggagtcatcaaagttttcaatgacatgaaggta cgtaagtcctcaacaccagaggaggtgaagaagcgcaagaaggcggtgctcttctgcctg agtgaggacaagaagaacatcattctggaagagggcaaggagatcctggtaggtgatgtg ggccagacagtagacgacccctacgccactttcgtcaagatgctgccggacaaagactgc cgttatgccctgtatgacgcaacctatgagaccaaggagagcaagaaggaggacctggtg tttatcttctgggctcctgagtctgcgcctcttaagagcaaaatgatctatgccagctcc aaggatgccatcaagaagaagcttacggggatcaagcatgaattacaagcaaactgctac gaggaggtcaaggaccgctgcactctggcagagaagctggggggcagtgctgtcatctcc ctggagggcaagcctttgtga

DBGET integrated database retrieval system