Mycobacterium dioxanotrophicus: BTO20_25360 Help Entry BTO20_25360       CDS       T05102                                  Name (GenBank) glutaredoxin-like protein   KO K18917   mycoredoxin [EC:1.20.4.3] Organism mdx  Mycobacterium dioxanotrophicus Brite KEGG Orthology (KO) [BR:mdx00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     BTO20_25360 Enzymes [BR:mdx01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      BTO20_25360 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 Thioredoxin_2 GST_N_3 Glrx-like Thioredoxin HCBP_related Motif Other DBs NCBI-ProteinID:  ART71429 UniProt:  A0A1Y0C894 LinkDB All DBs Position 5224842..5225063 Genome browser AA seq 73 aa AA seqDB search MYTTSWCGYCRRLKTALRAEGIGWTEVDIEGDPAAAEFVGSVNGGNHVVPTVKFADGSTL TNPSVKQIKAKLG NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgtacacgaccagctggtgcggctattgccggcggctgaagacagccctgcgcgccgaa ggcatcggctggaccgaggtcgacatcgagggcgaccccgccgcagcagagttcgtgggt tcggtcaacggcggcaaccatgtggtgccgacggtgaagttcgccgacgggtcgacgctg accaacccgagcgtcaagcagatcaaagccaagctgggctag

DBGET integrated database retrieval system