Methanonatronarchaeum sp. AMET6-2: MU439_04520 Help Entry MU439_04520       CDS       T08077                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism meam  Methanonatronarchaeum sp. AMET6-2 Pathway meam03010   Ribosome Brite KEGG Orthology (KO) [BR:meam00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MU439_04520   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MU439_04520  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:meam03011]     MU439_04520    04121 Ubiquitin system [BR:meam04121]     MU439_04520   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:meam04147]     MU439_04520 Ribosome [BR:meam03011]  Ribosomal proteins   Eukaryotes    Small subunit     MU439_04520   Archaea     MU439_04520 Ubiquitin system [BR:meam04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MU439_04520 Exosome [BR:meam04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    MU439_04520   Exosomal proteins of colorectal cancer cells    MU439_04520 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Ribosomal_L37e IBR Zn_ribbon_IS1595 Zn_ribbon_3 Zn_ribbon_NUD FtrD-like zf-CCHC_5 Zn_ribbon_Nudix Baculo_ME53 Lar_restr_allev Cas12f1-like_TNB Zn_Ribbon_TF DUF1451 Fer4_6 Zn_ribbon_LysW Motif Other DBs NCBI-ProteinID:  UOY09522 LinkDB All DBs Position 856408..856554 Genome browser AA seq 48 aa AA seqDB search MNKREIYEVKDDKIERNRENCPRCGKGVFMADHGDRLACGKCGYTEFK NT seq 147 nt NT seq  +upstreamnt  +downstreamnt atgaacaagagagaaatctacgaagtgaaagatgacaaaatcgagagaaaccgtgagaac tgccccagatgtggaaaaggagtgttcatggcagaccatggagaccgacttgcctgcggc aaatgcggatacaccgagtttaaataa

DBGET integrated database retrieval system