Mercurialis annua (annual mercury): 126664572 Help Entry 126664572         CDS       T10153                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism mean  Mercurialis annua (annual mercury) Pathway mean04145   Phagosome mean04148   Efferocytosis mean04517   IgSF CAM signaling mean04518   Integrin signaling mean04620   Toll-like receptor signaling pathway mean05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:mean00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     126664572    04518 Integrin signaling     126664572  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     126664572    04148 Efferocytosis     126664572  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     126664572  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     126664572  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mean04131]     126664572   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mean04147]     126664572    04031 GTP-binding proteins [BR:mean04031]     126664572 Membrane trafficking [BR:mean04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     126664572  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     126664572   Macropinocytosis    Ras GTPases     126664572  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     126664572 Exosome [BR:mean04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    126664572   Exosomal proteins of other body fluids (saliva and urine)    126664572   Exosomal proteins of colorectal cancer cells    126664572   Exosomal proteins of bladder cancer cells    126664572 GTP-binding proteins [BR:mean04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     126664572 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  126664572 NCBI-ProteinID:  XP_050212978 LinkDB All DBs Position LG1-X:72542854..72545831 Genome browser AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL DLREDKQFFIDHPGALPITTAQGEELRKLIGAPAYIECSSKTQQNVKGVFDAAIKVVLQP PKQKKKKKKGQKGCSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagcgcctctcggttcatcaagtgcgtcaccgtcggcgatggtgccgtcggtaaaacc tgcatgcttatttcttacaccagcaacacttttcctacggactatgtgccaactgttttt gacaacttcagtgcaaatgtagttgtggatgggagcactgtcaatttaggactatgggat acagctggccaggaagattacaataggttacggcctttgagttatcgaggggctgatgtg tttattctcgccttctctctaatcagcaaggccagctatgaaaatgtcgccaaaaagtgg atacctgaactgaggcattatgcacctggagttccaatcattcttgttggaacaaaacta gatcttcgggaggataagcagtttttcattgatcatcctggtgcactacctattactact gctcagggagaggaactgagaaaacttatcggagctcctgcctacatcgaatgcagctca aaaacgcagcagaatgtgaagggagtttttgatgcggccatcaaagtggtcctccagcca ccaaagcaaaagaagaagaagaaaaagggacaaaaaggttgctcaatattgtga

DBGET integrated database retrieval system