Mercurialis annua (annual mercury): 126664572 Help Entry 126664572         CDS       T10153                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism mean  Mercurialis annua (annual mercury) Pathway mean04145   Phagosome mean04148   Efferocytosis mean04620   Toll-like receptor signaling pathway mean05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:mean00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     126664572    04148 Efferocytosis     126664572  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     126664572  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     126664572  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mean04131]     126664572   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mean04147]     126664572    04031 GTP-binding proteins [BR:mean04031]     126664572 Membrane trafficking [BR:mean04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     126664572  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     126664572   Macropinocytosis    Ras GTPases     126664572  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     126664572 Exosome [BR:mean04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    126664572   Exosomal proteins of other body fluids (saliva and urine)    126664572   Exosomal proteins of colorectal cancer cells    126664572   Exosomal proteins of bladder cancer cells    126664572 GTP-binding proteins [BR:mean04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     126664572 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  126664572 NCBI-ProteinID:  XP_050212978 LinkDB All DBs Position LG1-X:72542854..72545831 Genome browser AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL DLREDKQFFIDHPGALPITTAQGEELRKLIGAPAYIECSSKTQQNVKGVFDAAIKVVLQP PKQKKKKKKGQKGCSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagcgcctctcggttcatcaagtgcgtcaccgtcggcgatggtgccgtcggtaaaacc tgcatgcttatttcttacaccagcaacacttttcctacggactatgtgccaactgttttt gacaacttcagtgcaaatgtagttgtggatgggagcactgtcaatttaggactatgggat acagctggccaggaagattacaataggttacggcctttgagttatcgaggggctgatgtg tttattctcgccttctctctaatcagcaaggccagctatgaaaatgtcgccaaaaagtgg atacctgaactgaggcattatgcacctggagttccaatcattcttgttggaacaaaacta gatcttcgggaggataagcagtttttcattgatcatcctggtgcactacctattactact gctcagggagaggaactgagaaaacttatcggagctcctgcctacatcgaatgcagctca aaaacgcagcagaatgtgaagggagtttttgatgcggccatcaaagtggtcctccagcca ccaaagcaaaagaagaagaagaaaaagggacaaaaaggttgctcaatattgtga

DBGET integrated database retrieval system