KEGG   Mercurialis annua (annual mercury): 126682583
Entry
126682583         CDS       T10153                                 
Name
(RefSeq) SKP1-like protein 1A
  KO
K03094  S-phase kinase-associated protein 1
Organism
mean  Mercurialis annua (annual mercury)
Pathway
mean03083  Polycomb repressive complex
mean04120  Ubiquitin mediated proteolysis
mean04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mean00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    126682583
   04120 Ubiquitin mediated proteolysis
    126682583
  09126 Chromosome
   03083 Polycomb repressive complex
    126682583
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mean04131]
    126682583
   04121 Ubiquitin system [BR:mean04121]
    126682583
   03036 Chromosome and associated proteins [BR:mean03036]
    126682583
Membrane trafficking [BR:mean04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    126682583
Ubiquitin system [BR:mean04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   SCF complex
    Adaptor protein
     126682583
   Cul7 complex
     126682583
Chromosome and associated proteins [BR:mean03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     126682583
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     126682583
SSDB
Motif
Pfam: Skp1 Skp1_POZ
Other DBs
NCBI-GeneID: 126682583
NCBI-ProteinID: XP_050234264
LinkDB
Position
LG5:11955879..11957081
AA seq 169 aa
MSKITTTSKKVTLRASDGETFEVEQAVASVSQTIKLLIEDGCADGVIPVPNVTGKILSMV
LEYAEKHKRTSAAATLYGPCDDESIIIARWDAEFMKLDRNVLFTLMMAADYLNMKGLLDL
TCKTVADMIKGKTPEQIRETFDIENDFNEEEEKEVRRENNWALQGAYHQ
NT seq 510 nt   +upstreamnt  +downstreamnt
atgtcgaagatcacgaccacatccaagaaagtaacactgagagcatcagacggggagaca
ttcgaggtggaacaagcggtggcttcggtgtctcagacgatcaaattactgatcgaagat
ggctgcgccgacggcgttatccctgttcctaacgtcaccggaaagattctctctatggtt
cttgagtatgccgagaaacataaacggacttctgctgctgctactctctatggtccttgt
gatgatgaaagtattattattgcacgttgggatgctgagtttatgaaacttgaccgaaat
gtcctctttactctcatgatggctgctgactatctgaacatgaagggtttgctggacttg
acttgtaaaacagttgctgatatgataaaggggaagacaccggagcagattcgcgagaca
ttcgacatcgagaatgattttaacgaagaggaagaaaaggaggttcgaagggagaacaat
tgggctttacagggtgcatatcatcaatga

DBGET integrated database retrieval system