Mercurialis annua (annual mercury): 126682667 Help Entry 126682667         CDS       T10153                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism mean  Mercurialis annua (annual mercury) Pathway mean03083   Polycomb repressive complex mean04120   Ubiquitin mediated proteolysis mean04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:mean00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     126682667    04120 Ubiquitin mediated proteolysis     126682667   09126 Chromosome    03083 Polycomb repressive complex     126682667  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mean04131]     126682667    04121 Ubiquitin system [BR:mean04121]     126682667    03036 Chromosome and associated proteins [BR:mean03036]     126682667 Membrane trafficking [BR:mean04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     126682667 Ubiquitin system [BR:mean04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      126682667    Cul7 complex      126682667 Chromosome and associated proteins [BR:mean03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      126682667   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      126682667 SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ BTB Motif Other DBs NCBI-GeneID:  126682667 NCBI-ProteinID:  XP_050234364 LinkDB All DBs Position LG5:11977107..11978256 Genome browser AA seq 150 aa AA seqDB search MSTTKKITLKASDGETFEVEQAVALESETIKYMIEDGCADSVIPVPNVTGKILSMVLEYA RKHNGTTAANEDIKCWDADFIKVDQNVLYELTLAANYLNMKGLLDLACETVADMIRGKTP EQIRKTFNIANDFTEEEEEEVRRDNRWAFE NT seq 453 nt NT seq  +upstreamnt  +downstreamnt atgtcgacgacgaagaaaataacactgaaagcatcagatggggagacattcgaggtggaa caagcggtggctttggagtctgaaacgatcaaatacatgatcgaagatggctgcgccgac agcgttatcccggttcctaacgtcaccggaaagatactctctatggttctcgagtatgcc aggaaacataacgggactactgctgctaatgaagatattaaatgttgggatgctgatttt atcaaagtcgaccaaaatgtcctctatgagctcaccctggctgctaactatctcaacatg aaaggtttgctggacttggcttgtgaaacagtggctgatatgataagggggaagacgccg gagcagattcgcaagacattcaacatcgccaacgatttcaccgaagaggaagaagaggag gttcgtagggacaaccgatgggcttttgagtga

DBGET integrated database retrieval system