Methanobrevibacter sp. AbM4: Abm4_0721 Help Entry Abm4_0721         CDS       T02687                                  Name (GenBank) ribosomal protein S27ae Rps27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism meb  Methanobrevibacter sp. AbM4 Pathway meb03010   Ribosome Brite KEGG Orthology (KO) [BR:meb00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Abm4_0721   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Abm4_0721  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:meb03011]     Abm4_0721    04121 Ubiquitin system [BR:meb04121]     Abm4_0721   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:meb04147]     Abm4_0721 Ribosome [BR:meb03011]  Ribosomal proteins   Eukaryotes    Small subunit     Abm4_0721   Archaea     Abm4_0721 Ubiquitin system [BR:meb04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Abm4_0721 Exosome [BR:meb04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Abm4_0721   Exosomal proteins of colorectal cancer cells    Abm4_0721 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Phage_zn_bind_2 Ribosomal_L37e Zn_ribbon_IS1595 Zn_ribbon_NUD Zn_Ribbon_TF Lar_restr_allev Zn_ribbon_Nudix Cas12f1-like_TNB Zn_ribbon_TiaS zf-ChsH2 Zn_ribbon_8 Zn_ribbon_RPB9 Zn_ribbon_19 DUF6758 Motif Other DBs NCBI-GeneID:  15798215 NCBI-ProteinID:  AGN16614 UniProt:  R9SKH6 LinkDB All DBs Position 897818..897973 Genome browser AA seq 51 aa AA seqDB search MKVSSLYEVKDDKLERKNPVCPRCGGGVFMADHGDRYACGKCGYTEMKNKD NT seq 156 nt NT seq  +upstreamnt  +downstreamnt atgaaagtatctagtttatatgaagtaaaagatgataaattagaaagaaaaaatccagta tgtcctcgttgtggtggaggagtctttatggctgaccacggtgacagatacgcatgtggt aaatgcggatatactgaaatgaaaaacaaagattaa

DBGET integrated database retrieval system