KEGG   Methylophaga frappieri: Q7C_602
Entry
Q7C_602           CDS       T02056                                 
Name
(GenBank) Phosphopantetheine adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
mec  Methylophaga frappieri
Pathway
mec00770  Pantothenate and CoA biosynthesis
mec01100  Metabolic pathways
mec01240  Biosynthesis of cofactors
Module
mec_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:mec00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Q7C_602
Enzymes [BR:mec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     Q7C_602
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Other DBs
NCBI-ProteinID: AFJ01774
UniProt: I1YFT1
LinkDB
Position
complement(660849..661340)
AA seq 163 aa
MAITAIYPGTFDPVTHGHTDLVNRASRLFERLIVAVAADTGKHSLFDLDQRVAMAQEIFK
DFDNVEVAGFTGLLVNFASQKQANVIIRGLRAVSDFEYEVQLAAINRRLHVEVETLFLAP
AEQYTFVSSSLVRQIALLGGDVSQFVAPCVQKAFIEYLEANPK
NT seq 492 nt   +upstreamnt  +downstreamnt
atggcgataacagcgatttacccagggacgtttgatccggtcacgcatggccacacagat
ttggttaatcgagccagtcggttatttgaaagattaattgtggcggtggctgccgataca
ggtaaacacagtttgtttgacctcgatcaacgggttgccatggcgcaagaaatttttaaa
gacttcgataatgttgaagtggccggttttacaggcctgctggttaattttgccagtcag
aaacaggctaatgtgattattcgtggtttgcgcgcggtgtctgattttgaatatgaagtg
cagttagccgccattaaccgacgtctgcatgttgaagtggagacgctttttttggcgccg
gcagaacaatacacctttgtgtcttccagcctagtgcgccaaattgctttgctgggcggt
gatgtgtcgcagtttgttgccccttgtgttcaaaaagcatttattgaatatctggaagca
aaccccaaataa

DBGET integrated database retrieval system