Methylosinus sp. C49: MSC49_15320 Help Entry MSC49_15320       CDS       T09855                                  Name (GenBank) hypothetical protein   KO K02196   heme exporter protein D Organism mecq  Methylosinus sp. C49 Pathway mecq02010   ABC transporters Brite KEGG Orthology (KO) [BR:mecq00001]  09130 Environmental Information Processing   09131 Membrane transport    02010 ABC transporters     MSC49_15320  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:mecq02000]     MSC49_15320 Transporters [BR:mecq02000]  ABC transporters, prokaryotic type   ABC-2 type and other transporters    Heme transporter     MSC49_15320 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CcmD WH4_Lhr LapA_dom Motif Other DBs NCBI-ProteinID:  BBU61597 UniProt:  A0A679F2P2 LinkDB All DBs Position 1620055..1620216 Genome browser AA seq 53 aa AA seqDB search MTEEHWGYIVLAYGVTAATILIMAFRILLEHRRLAAELARLEKNGSVARGEPL NT seq 162 nt NT seq  +upstreamnt  +downstreamnt atgaccgaagagcattggggctatattgtgctggcctatggcgtgaccgccgccaccatc ctcatcatggcctttcgcattctgctggagcatagacgcctcgccgccgagctcgcgcgg ctcgagaagaatggttccgtcgcgagaggggagccgctgtga

DBGET integrated database retrieval system