KEGG   Methylocapsa sp. D3K7: QEV83_04470
Entry
QEV83_04470       CDS       T08996                                 
Symbol
coaD
Name
(GenBank) pantetheine-phosphate adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
medk  Methylocapsa sp. D3K7
Pathway
medk00770  Pantothenate and CoA biosynthesis
medk01100  Metabolic pathways
medk01240  Biosynthesis of cofactors
Module
medk_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:medk00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    QEV83_04470 (coaD)
Enzymes [BR:medk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     QEV83_04470 (coaD)
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Other DBs
NCBI-ProteinID: WGJ15531
LinkDB
Position
972729..973229
AA seq 166 aa
MHRVALYAGSFDPLTNGHVDIIERAGALCDALIVAIGTHPGKAPMFSTTERASLLEAVFK
DLTGAPACKLSVRMFSGLAVDAARAAGASLLLRGLRDGTDLDDEMRMAAMNAVMAPEIKT
VFLAASPPVRHISATLVRQIAGLGGDVSAFVPAAVAQALVNRRAAG
NT seq 501 nt   +upstreamnt  +downstreamnt
atgcaccgcgtcgcactttatgcggggtcgttcgacccgctgaccaacgggcatgtcgat
atcatcgaacgcgccggagctttgtgcgacgcgcttatcgtggcgatcggcactcatccc
ggcaaggctccaatgttcagcactaccgagcgagcctcccttcttgaggcggtgttcaag
gatcttaccggggctcccgcgtgcaagctttcggtgcgcatgttttccggtctcgcggtc
gatgccgcgcgcgccgccggggcgagcctgctgctgcgcggccttcgcgatggcaccgac
cttgatgacgagatgcgcatggcggcgatgaacgccgtgatggcgccggaaatcaaaacg
gtgtttttggccgcttcgccgccggttcgtcacattagcgcgacattggtgcggcagatc
gccgggctcggcggcgacgtgtcggccttcgtacccgccgcggtcgcgcaagcgctcgtc
aaccggagagcggcgggatga

DBGET integrated database retrieval system