Methylocapsa sp. D3K7: QEV83_14235 Help Entry QEV83_14235       CDS       T08996                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism medk  Methylocapsa sp. D3K7 Pathway medk01100   Metabolic pathways medk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:medk00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     QEV83_14235    00074 Mycolic acid biosynthesis     QEV83_14235   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     QEV83_14235 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  WGJ13827 LinkDB All DBs Position 3005964..3006203 Genome browser AA seq 79 aa AA seqDB search MSDVAERVKKIVVEHLGVDADKVVDGANFMEDLGADSLDTVELVMAFEEEFGVEIPDDAA ETIVTVGDAIKFLDKASAA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatgtcgccgagcgcgtgaaaaaaattgtggtcgagcacctcggcgtcgatgcc gacaaagttgtcgatggcgccaacttcatggaagaccttggcgcggattccctcgacacg gtcgagctcgtcatggctttcgaggaagaattcggcgtcgagattccagatgatgccgcc gaaacgatcgtgaccgtgggcgatgccataaaatttcttgataaggcatccgccgcctga

DBGET integrated database retrieval system