Methylocapsa sp. D3K7: QEV83_16430 Help Entry QEV83_16430       CDS       T08996                                  Symbol groES Name (GenBank) co-chaperone GroES   KO K04078   chaperonin GroES Organism medk  Methylocapsa sp. D3K7 Brite KEGG Orthology (KO) [BR:medk00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:medk03110]     QEV83_16430 (groES)    03029 Mitochondrial biogenesis [BR:medk03029]     QEV83_16430 (groES) Chaperones and folding catalysts [BR:medk03110]  Heat shock proteins   HSP10    QEV83_16430 (groES) Mitochondrial biogenesis [BR:medk03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     QEV83_16430 (groES) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  WGJ14217 LinkDB All DBs Position complement(3489502..3489789) Genome browser AA seq 95 aa AA seqDB search MSFRPLHDRVVVRRLEGEEKTKGGIIIPDTVKEKPQEGEIIAVGPGGRDESGKLTPLDVK AGDKILFGKWSGTEVKIDGQDLLIMKESDILGVVA NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgagctttcgtccattgcatgaccgcgtcgtggtcagacgactcgaaggtgaggaaaag accaaaggcgggatcattatccccgatacggtcaaggagaagccccaggaaggcgaaatt atcgctgtgggccccggcggccgcgatgaaagcggcaagctcacgccgcttgatgtcaag gcgggggacaagattctgttcggcaaatggtcgggcaccgaggtcaagatcgatggtcag gatctcctgatcatgaaggagagcgatatcctgggcgtcgtcgcctaa

DBGET integrated database retrieval system