Mycoplasmopsis edwardii: NCTC10132_00279 Help Entry NCTC10132_00279   CDS       T07092                                  Symbol MCYN0201 Name (GenBank) Acyl carrier protein (ACP)   KO K02078   acyl carrier protein Organism medw  Mycoplasmopsis edwardii Pathway medw01100   Metabolic pathways medw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:medw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NCTC10132_00279 (MCYN0201)    00074 Mycolic acid biosynthesis     NCTC10132_00279 (MCYN0201)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NCTC10132_00279 (MCYN0201) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  SYV96935 UniProt:  A0A3B0PQB9 LinkDB All DBs Position 1:155470..155694 Genome browser AA seq 74 aa AA seqDB search MKNIKQQVLDNFTRVARKKVTENDDIKALNIDSLDLAEIIVLAEEEFNISISDEELMSLV LVSDVIKLIKSKHE NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgaagaatattaaacaacaggttttagataattttacaagagtagctagaaagaaagtt acagaaaatgatgatataaaagcattgaatattgattcattagatttagctgaaattatt gttttagcagaagaagagtttaatatttcaatatcagatgaagaactaatgtctttagtt ctagtatcagatgtcatcaaattaatcaaaagcaaacatgagtag

DBGET integrated database retrieval system