Mycoplasmopsis edwardii: NCTC10132_00617 Help Entry NCTC10132_00617   CDS       T07092                                  Name (GenBank) Uncharacterised protein   KO K07589   D-erythro-7,8-dihydroneopterin triphosphate epimerase [EC:5.1.99.7] Organism medw  Mycoplasmopsis edwardii Pathway medw00790   Folate biosynthesis Brite KEGG Orthology (KO) [BR:medw00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     NCTC10132_00617 Enzymes [BR:medw01000]  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.7  dihydroneopterin triphosphate 2'-epimerase      NCTC10132_00617 SSDB OrthologParalogGFIT Other DBs NCBI-ProteinID:  SYV97258 UniProt:  A0A3B0PJ00 LinkDB All DBs Position 1:complement(<367928..368125) Genome browser AA seq 66 aa AA seqDB search MNSTEFLISKLLIQNYISIKDLDPEDFNDEDIKKNIEINKIDLNKKNSKKIDDAINFIIN DKKVIW NT seq 198 nt NT seq  +upstreamnt  +downstreamnt ttgaattctacagaatttttaatttctaaattattgatacaaaattatatatctatcaaa gatttagatcctgaagactttaatgatgaagatataaagaaaaatattgaaataaataag attgatttaaataagaaaaatagtaaaaaaatagatgatgcaataaatttcattattaat gataaaaaagttatatga

DBGET integrated database retrieval system