Methylobacterium currus: DA075_15860 Help Entry DA075_15860       CDS       T05184                                  Name (GenBank) hypothetical protein   KO K03557   Fis family transcriptional regulator, factor for inversion stimulation protein Organism mee  Methylobacterium currus Brite KEGG Orthology (KO) [BR:mee00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mee03000]     DA075_15860    03036 Chromosome and associated proteins [BR:mee03036]     DA075_15860    03400 DNA repair and recombination proteins [BR:mee03400]     DA075_15860 Transcription factors [BR:mee03000]  Prokaryotic type   Helix-turn-helix    Other families     DA075_15860 Chromosome and associated proteins [BR:mee03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     DA075_15860 DNA repair and recombination proteins [BR:mee03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Facilitator       DA075_15860 SSDB OrthologParalogGFIT Motif Pfam:  HTH_8 HTH_30 HTH_23 DUF2089 HTH_28 HTH_Tnp_ISL3 HTH_50 HTH_11 Sigma70_r4_2 HTH_29 HTH_17 MerR HTH_1 DUF1670 Sigma70_r4 Motif Other DBs NCBI-ProteinID:  AWB22216 UniProt:  A0A2R4WL29 LinkDB All DBs Position 1:complement(3389685..3389945) Genome browser AA seq 86 aa AA seqDB search MAPATTLAEAERKLVIETLIRCRGNRTHAAKMLGISVRTVRNRIAEYRRIGVCLPIYRDV VWSDWPEGEFSLEEAGMMGGPVEGTA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atggcgccagcgaccaccctcgcggaggccgagcgcaagctcgtcatcgagacgctcatc cgttgccgcggcaaccgcacccacgccgccaagatgctcggcatctcggtccgcacggtg cgcaaccggatcgcggaatacaggaggatcggtgtctgcctgccgatctaccgcgacgtc gtgtggtccgactggccggaaggggaattctcgctggaggaggccgggatgatgggcggg ccggtggaggggacggcctga

DBGET integrated database retrieval system