Methylococcus sp. EFPC2: JWZ97_09640 Help Entry JWZ97_09640       CDS       T10116                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism meef  Methylococcus sp. EFPC2 Brite KEGG Orthology (KO) [BR:meef00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:meef03032]     JWZ97_09640    03036 Chromosome and associated proteins [BR:meef03036]     JWZ97_09640    03400 DNA repair and recombination proteins [BR:meef03400]     JWZ97_09640 DNA replication proteins [BR:meef03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     JWZ97_09640 Chromosome and associated proteins [BR:meef03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     JWZ97_09640 DNA repair and recombination proteins [BR:meef03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       JWZ97_09640 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 Lmo2446-like_N HU-CCDC81_euk_2 HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  QSA95519 UniProt:  A0A974ZMP5 LinkDB All DBs Position complement(2283718..2283990) Genome browser AA seq 90 aa AA seqDB search MNKAELIEAIAESADLTKADAGRALDGFIAAVTGALKKGETVSLVGFGSFGVKERAERQG RNPQTGNSITIKAAKIPSFKAGKALKDEVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaataaggcagaacttatagaagcgatcgcagaatcggcggacctgaccaaggcagac gcagggcgggcgctggatgggtttatcgctgctgttactggcgccttgaaaaaaggagag accgtgtccttggtgggatttggctcgtttggagtaaaagaacgtgcggagcgacagggg cgcaatccgcaaaccggaaatagcatcactattaaggctgcaaaaattccttcatttaaa gctggtaaagcgctgaaagatgaagtaaactaa

DBGET integrated database retrieval system