Methylomonas sp. EFPC1: JWZ98_03545 Help Entry JWZ98_03545       CDS       T10319                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism meep  Methylomonas sp. EFPC1 Pathway meep01100   Metabolic pathways meep01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:meep00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JWZ98_03545    00074 Mycolic acid biosynthesis     JWZ98_03545   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JWZ98_03545 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QSB02048 LinkDB All DBs Position complement(755550..755807) Genome browser AA seq 85 aa AA seqDB search MSEMETELKHLIIDTLALEDVDVADIDSHAALFNDGLGLDSIDALELGLAIRKKYQVKID AEQDDVVKIFGSVAALAQFIEAARS NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgagcgagatggaaactgaattaaaacacctgattatcgacacgctggcgctggaagat gtcgatgtagcggacatcgatagccacgccgctttgttcaatgacggcctgggcctggac tctatagacgcgctggaactgggattggcgatacgtaaaaaatatcaggtaaaaattgat gccgagcaggacgacgtggtgaaaatcttcggttccgtggcagccttggcgcaatttatc gaagcggcgcggagttga

DBGET integrated database retrieval system