Methanobacterium sp. ERen5: NKF70_03695 Help Entry NKF70_03695       CDS       T10395                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism meer  Methanobacterium sp. ERen5 Pathway meer03010   Ribosome Brite KEGG Orthology (KO) [BR:meer00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     NKF70_03695   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     NKF70_03695  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:meer03011]     NKF70_03695    04121 Ubiquitin system [BR:meer04121]     NKF70_03695   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:meer04147]     NKF70_03695 Ribosome [BR:meer03011]  Ribosomal proteins   Eukaryotes    Small subunit     NKF70_03695   Archaea     NKF70_03695 Ubiquitin system [BR:meer04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    NKF70_03695 Exosome [BR:meer04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    NKF70_03695   Exosomal proteins of colorectal cancer cells    NKF70_03695 SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 Ribosomal_L37e Alsin_RLD Motif Other DBs NCBI-ProteinID:  UTB33375 LinkDB All DBs Position 673228..673392 Genome browser AA seq 54 aa AA seqDB search MKKFELYEVKDNKIIRKNPECVRCSHGVFMADHGDRYACGKCGYTQFKGKENKK NT seq 165 nt NT seq  +upstreamnt  +downstreamnt atgaaaaaatttgaactctacgaagttaaagataacaagatcatcagaaaaaatccagaa tgtgttagatgttcccacggagttttcatggctgaccatggagacagatacgcctgtgga aaatgtggatacacacagtttaaaggtaaagaaaacaagaaataa

DBGET integrated database retrieval system