Methanimicrococcus stummii: MmiEs2_01540 Help Entry MmiEs2_01540      CDS       T09451                                  Name (GenBank) hypothetical protein   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism mees  Methanimicrococcus stummii Pathway mees03060   Protein export mees04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:mees00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     MmiEs2_01540    04141 Protein processing in endoplasmic reticulum     MmiEs2_01540  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     MmiEs2_01540  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mees04131]     MmiEs2_01540   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:mees02044]     MmiEs2_01540 Membrane trafficking [BR:mees04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     MmiEs2_01540 Secretion system [BR:mees02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    MmiEs2_01540 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SecE Motif Other DBs NCBI-ProteinID:  WNY27974 UniProt:  A0AA96V7G5 LinkDB All DBs Position 150033..150263 Genome browser AA seq 76 aa AA seqDB search MAENNTADKVKDGIANIGPTLRSYLRILKLARKPSRKEFLTIAKVAALGILAIGVMGFIF YVLMDIVPEYFIPIRT NT seq 231 nt NT seq  +upstreamnt  +downstreamnt ttggcagaaaacaacacggcagataaagtgaaggacggcattgcaaacatcggtccgaca cttcgttcttacctcagaattttaaaattggcccgcaagccgtctcgcaaagaattctta acgattgcaaaagttgcagcgctcggtattctcgcaatcggtgtcatgggctttattttc tatgtcttgatggacatcgttccggaatatttcatcccgatcagaacataa

DBGET integrated database retrieval system