Methanosarcina sp. WH1: MSWH1_2399 Help Entry MSWH1_2399        CDS       T03851                                  Name (GenBank) SSU ribosomal protein S27Ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mef  Methanosarcina sp. WH1 Pathway mef03010   Ribosome Brite KEGG Orthology (KO) [BR:mef00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MSWH1_2399   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MSWH1_2399  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mef03011]     MSWH1_2399    04121 Ubiquitin system [BR:mef04121]     MSWH1_2399   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mef04147]     MSWH1_2399 Ribosome [BR:mef03011]  Ribosomal proteins   Eukaryotes    Small subunit     MSWH1_2399   Archaea     MSWH1_2399 Ubiquitin system [BR:mef04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MSWH1_2399 Exosome [BR:mef04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    MSWH1_2399   Exosomal proteins of colorectal cancer cells    MSWH1_2399 SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_Nudix Ribosomal_L37e Rcat_RNF216 IBR_1 Zn_ribbon_RPB9 IBR Zn_Ribbon_TF Zn_ribbon_3 Cas12f1-like_TNB DUF6671 Zn_ribbon_11 DUF1451 MqsA_antitoxin Zn_ribbon_IS1595 Zn_ribbon_NOB1 Motif Other DBs NCBI-ProteinID:  AKB22670 LinkDB All DBs Position complement(2943029..2943178) Genome browser AA seq 49 aa AA seqDB search MAVKDYYKVQGDSVTRLKQFCPRCGPGIFLADHKNRLACGKCGYTEFKK NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggcagtaaaagattactacaaagtccagggcgactccgtaaccagactcaaacagttt tgtccaagatgcggaccaggtatattccttgccgaccacaaaaaccgtctcgcctgcggg aagtgcggctataccgagttcaagaagtaa

DBGET integrated database retrieval system