Methanosarcina sp. WH1: MSWH1_2770 Help Entry MSWH1_2770        CDS       T03851                                  Name (GenBank) LSU ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism mef  Methanosarcina sp. WH1 Pathway mef03010   Ribosome Brite KEGG Orthology (KO) [BR:mef00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MSWH1_2770   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MSWH1_2770  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mef03011]     MSWH1_2770    04121 Ubiquitin system [BR:mef04121]     MSWH1_2770 Ribosome [BR:mef03011]  Ribosomal proteins   Eukaryotes    Large subunit     MSWH1_2770   Archaea     MSWH1_2770 Ubiquitin system [BR:mef04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MSWH1_2770 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e Zn_Ribbon_1 DZR DZR_2 zf-AtTam37 Zn_ribbon_RPAB4 Zn_ribbon_ZPR1 Zn_ribbon_3 zf-ChsH2 DHHC Motif Other DBs NCBI-ProteinID:  AKB23041 UniProt:  A0A0E3L5C7 LinkDB All DBs Position complement(3393579..3393728) Genome browser AA seq 49 aa AA seqDB search MGRFPEAEERLLNKKICMKCNARNAIRATRCRKCGYGALRVKSKESKGA NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atgggtcgttttccagaagccgaagaaagattattaaacaaaaaaatctgcatgaagtgt aatgccagaaatgccatacgggcaacccgctgcagaaaatgtggctacggtgctcttcgc gtgaaatctaaggaatccaagggagcatga

DBGET integrated database retrieval system