Methanochimaera problematica: F1737_10485 Help Entry F1737_10485       CDS       T09667                                  Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism mefw  Methanochimaera problematica Pathway mefw03010   Ribosome Brite KEGG Orthology (KO) [BR:mefw00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     F1737_10485   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     F1737_10485  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mefw03011]     F1737_10485    04121 Ubiquitin system [BR:mefw04121]     F1737_10485 Ribosome [BR:mefw03011]  Ribosomal proteins   Eukaryotes    Large subunit     F1737_10485   Archaea     F1737_10485 Ubiquitin system [BR:mefw04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    F1737_10485 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e Zn_Ribbon_1 DZR Zn_ribbon_3 Zn_ribbon_RanBP DHHC Motif Other DBs NCBI-ProteinID:  WOF17071 UniProt:  A0AA97I548 LinkDB All DBs Position complement(2070040..2070186) Genome browser AA seq 48 aa AA seqDB search MARFPEAEARLLDVKICMKCNARNAPRATKCRKCGYDGLRPKSKERKG NT seq 147 nt NT seq  +upstreamnt  +downstreamnt atggcaagatttccagaggccgaggcaaggctccttgacgtaaaaatctgcatgaaatgt aatgcaagaaacgcacctcgtgcaacaaagtgtcgcaaatgtggatatgatggtttaaga ccaaaatcaaaggagagaaaaggataa

DBGET integrated database retrieval system