Methanochimaera problematica: F1737_10525 Help Entry F1737_10525       CDS       T09667                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mefw  Methanochimaera problematica Pathway mefw03010   Ribosome Brite KEGG Orthology (KO) [BR:mefw00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     F1737_10525   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     F1737_10525  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mefw03011]     F1737_10525    04121 Ubiquitin system [BR:mefw04121]     F1737_10525   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mefw04147]     F1737_10525 Ribosome [BR:mefw03011]  Ribosomal proteins   Eukaryotes    Small subunit     F1737_10525   Archaea     F1737_10525 Ubiquitin system [BR:mefw04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    F1737_10525 Exosome [BR:mefw04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    F1737_10525   Exosomal proteins of colorectal cancer cells    F1737_10525 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Rcat_RNF216 Ribosomal_L37e Zn_ribbon_11 IBR Lar_restr_allev Cas12f1-like_TNB Zn_ribbon_RPAB4 Zn_ribbon_NrdR MqsA_antitoxin Zn_ribbon_Nudix DUF1451 Zn_ribbon_13 Zn_ribbon_RPB9 Zn_ribbon_IS1595 Motif Other DBs NCBI-ProteinID:  WOF17077 UniProt:  A0AA97FDI7 LinkDB All DBs Position complement(2076366..2076521) Genome browser AA seq 51 aa AA seqDB search MAVKRHEYYKVEGDNAVAQRRHCPRCGPGVFMAEHKDRVACGKCGYTEFTK NT seq 156 nt NT seq  +upstreamnt  +downstreamnt atggcagtaaaacgtcacgagtattacaaggttgagggcgacaatgctgttgcacagcgc agacactgcccacgctgcggacctggtgttttcatggctgaacacaaggatcgcgttgca tgtggaaagtgcggatatacagaatttacaaaataa

DBGET integrated database retrieval system