Methylotenera versatilis: M301_2311 Help Entry M301_2311         CDS       T01247                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism meh  Methylotenera versatilis Pathway meh01100   Metabolic pathways meh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:meh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     M301_2311    00074 Mycolic acid biosynthesis     M301_2311   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     M301_2311 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ADI30676 UniProt:  D7DLY2 LinkDB All DBs Position 2549270..2549539 Genome browser AA seq 89 aa AA seqDB search MIETNTPLQLEIAELMVQALNLDVAAAEIVPDAQLYGSGLGLDSIDILEVALVVSKRYGL QLKSDNENNHQIFSSLRNLAEYVAVNKTK NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgatagaaactaatactcctttacaacttgaaattgctgaactgatggtacaggcattg aaccttgatgtcgctgccgctgaaatagtacctgatgctcagctatatggtagcggacta ggtttggattcgattgatattttggaagttgcacttgttgtttccaaacgatatggcctg caactgaaatcagataacgaaaataatcaccagattttcagttccctacgcaatcttgca gagtatgttgctgtcaataaaactaaataa

DBGET integrated database retrieval system