Methanimicrococcus hongohii: MmiHf6_06950 Help Entry MmiHf6_06950      CDS       T09450                                  Name (GenBank) hypothetical protein   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mehf  Methanimicrococcus hongohii Pathway mehf03010   Ribosome Brite KEGG Orthology (KO) [BR:mehf00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MmiHf6_06950   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MmiHf6_06950  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mehf03011]     MmiHf6_06950    04121 Ubiquitin system [BR:mehf04121]     MmiHf6_06950   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mehf04147]     MmiHf6_06950 Ribosome [BR:mehf03011]  Ribosomal proteins   Eukaryotes    Small subunit     MmiHf6_06950   Archaea     MmiHf6_06950 Ubiquitin system [BR:mehf04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MmiHf6_06950 Exosome [BR:mehf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    MmiHf6_06950   Exosomal proteins of colorectal cancer cells    MmiHf6_06950 SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 Zn_Ribbon_1 Zn_ribbon_Nudix DUF1451 Ribosomal_L37e Zn_ribbon_RPB9 Zn_ribbon_3 Zn_ribbon_NUD DZR DUF1936 Cas12f1-like_TNB Motif Other DBs NCBI-ProteinID:  WNY23388 UniProt:  A0AA96V1M4 LinkDB All DBs Position complement(856246..856395) Genome browser AA seq 49 aa AA seqDB search MAVKDYYKVEGDKVIRVNKFCPKCGPGVFLSEHKNRNACGKCGYTEFKN NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggcagtgaaagattactacaaagtcgaaggcgataaagtcatccgcgtcaacaaattc tgtccgaaatgcggtcccggcgttttcttgtccgaacacaagaacagaaacgcatgcggc aaatgcggatacacagaatttaaaaactga

DBGET integrated database retrieval system