Methyloprofundus sp. INp10_methR40d: methR_P1616 Help Entry methR_P1616       CDS       T07025                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mein  Methyloprofundus sp. INp10_methR40d Pathway mein01100   Metabolic pathways mein01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mein00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     methR_P1616    00074 Mycolic acid biosynthesis     methR_P1616   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     methR_P1616 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  BCG63871 UniProt:  A0A7R6W8X5 LinkDB All DBs Position 1811696..1811959 Genome browser AA seq 87 aa AA seqDB search MSQELVAELKTLFIEGLHLEDISADEIGVDDPLFGEGLGLDSIDALEIAVLLDRQYGVKI TSEDDRNQEIFASLNSLAEFVTENRSK NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgtctcaagagttggttgcggaattaaaaacattgttcattgaagggctgcacttagaa gatattagtgctgatgaaattggagttgacgaccccttgtttggtgagggtttggggtta gattcgattgatgctttagaaattgcagtcttattagatcgtcaatatggtgtaaaaatt acctcggaagatgatcgtaatcaagagatctttgcttcattaaattcattggctgaattt gtaacggaaaatagaagtaaatag

DBGET integrated database retrieval system