Methylophaga nitratireducenticrescens: Q7A_1272
Help
Entry
Q7A_1272 CDS
T02055
Name
(GenBank) pantetheine-phosphate adenylyltransferase
KO
K00954
pantetheine-phosphate adenylyltransferase [EC:
2.7.7.3
]
Organism
mej
Methylophaga nitratireducenticrescens
Pathway
mej00770
Pantothenate and CoA biosynthesis
mej01100
Metabolic pathways
mej01240
Biosynthesis of cofactors
Module
mej_M00120
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:
mej00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
Q7A_1272
Enzymes [BR:
mej01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.3 pantetheine-phosphate adenylyltransferase
Q7A_1272
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CTP_transf_like
Citrate_ly_lig
DUF3150
Motif
Other DBs
NCBI-ProteinID:
AFI84109
UniProt:
I1XI90
LinkDB
All DBs
Position
1269236..1269733
Genome browser
AA seq
165 aa
AA seq
DB search
MSITAIYPGTFDPITHGHTDLVQRASRLFEKVIVAVAADTGKKPVFSIEQRLALAKQTLD
DLPNIEITSFDGLLVNYAMQRNASVIIRGLRAVSDFEYEVQLAAMNRRLQWEVETLFLAP
AEQFTFISSSLIRQIAALGGDVSQFVAPCVQQALQQQLADKKQSS
NT seq
498 nt
NT seq
+upstream
nt +downstream
nt
atgtcaatcaccgccatctatccaggaacatttgatccgattacccacggtcatacagat
ttggttcagcgtgccagccgtttatttgaaaaagtgattgttgctgtcgctgcggacacc
gggaaaaaaccggtattttcaattgagcaacgtttggcattagcgaaacaaaccctggat
gatttacccaatatcgaaattacctccttcgatggtttattggtgaattatgcaatgcag
cgaaatgcctcagtaattattcgtggacttcgcgctgtttcagattttgaatacgaagtt
caacttgccgcaatgaatcgtcgtttacagtgggaagtggaaacattatttctggcgccg
gcagaacaatttacatttatttcatcaagcctgataagacaaatagcggctttgggtgga
gatgtctcccaatttgttgcgccctgtgtacaacaggcattacagcagcaactggcagac
aaaaaacagtcgagttaa
DBGET
integrated database retrieval system