Methylophaga nitratireducenticrescens: Q7A_2707
Help
Entry
Q7A_2707 CDS
T02055
Symbol
phnC
Name
(GenBank) phosphonate ABC transporter ATP-binding protein
KO
K02041
phosphonate transport system ATP-binding protein [EC:
7.3.2.2
]
Organism
mej
Methylophaga nitratireducenticrescens
Pathway
mej02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
mej00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
Q7A_2707 (phnC)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
mej02000
]
Q7A_2707 (phnC)
Enzymes [BR:
mej01000
]
7. Translocases
7.3 Catalysing the translocation of inorganic anions and their chelates
7.3.2 Linked to the hydrolysis of a nucleoside triphosphate
7.3.2.2 ABC-type phosphonate transporter
Q7A_2707 (phnC)
Transporters [BR:
mej02000
]
ABC transporters, prokaryotic type
Phosphate and amino acid transporters
Phosphonate transporter
Q7A_2707 (phnC)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_tran
AAA_21
SMC_N
AAA_13
RsgA_GTPase
AAA_29
AAA_16
AAA_15
nSTAND1
AAA_23
AAA_27
AAA_22
MMR_HSR1
TsaE
Motif
Other DBs
NCBI-ProteinID:
AFI85493
UniProt:
I1XM74
LinkDB
All DBs
Position
complement(2517931..2518785)
Genome browser
AA seq
284 aa
AA seq
DB search
MATTKAFQSILSVDNLGITYPGGIEALRSTSISFQRGEFNVLLGLSGAGKSSLLRALNHL
VKPTSGKVTSAEFGVLNNQRTLRRHRRKTAMVFQHHQLILRHTALQNVLMGRLGYHSFWR
SLLPMPRADLELALHCLDRVGLADKALSRIDQLSGGQQQRVGIARALAQQPDIILADEPV
ASLDPATSEKVLTLLKKICAEDGITAVVSLHQLEYARHFADRIIGLANAEVVFDASPTQL
DDTQLALIYKQAPTDLKKTSKTKPAEDSATNRLPSKTATQLEIA
NT seq
855 nt
NT seq
+upstream
nt +downstream
nt
atggctacaaccaaggcatttcaatcgattctctccgttgataatcttgggattacctat
cccggtgggatcgaagcattacgttccacttcaattagtttccaacgcggcgaatttaat
gtattgctcgggctttcaggtgctggaaagtcctcactgttaagagcgttgaatcattta
gtaaagcctacttctggaaaggtaacttcagccgagttcggggtgcttaataatcaacgt
actttacgccggcatcgtcgaaaaacagccatggtatttcagcaccatcaactgattctg
cgtcacaccgctttgcaaaatgtattgatgggacgattgggataccactctttctggcgg
agtttgttaccaatgccacgagccgatctggaactggctttgcattgtctggatcgggta
gggctggcagataaagcgttgagccgaatcgatcagctttccggcggtcagcagcagcgc
gtcggaattgcaagggctttggcccagcaacccgacattattctagctgatgagccagtg
gcaagtttggatccagccacctcggaaaaagtgcttactttgttgaaaaagatttgtgca
gaagatggcatcaccgccgtggtttcgttgcatcaattggaatatgccaggcattttgcc
gatcgcattattggcctggcgaatgccgaagtggtatttgatgcttcaccgacacagctg
gacgatacacaactggcgttaatttataaacaagcccctaccgacctcaaaaaaacatcg
aaaaccaaacccgccgaggattcggcaactaatcgtttaccctcaaaaactgctactcaa
ttggagattgcgtga
DBGET
integrated database retrieval system