Methanosarcina sp. Kolksee: MSKOL_3214 Help Entry MSKOL_3214        CDS       T03821                                  Name (GenBank) LSU ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism mek  Methanosarcina sp. Kolksee Pathway mek03010   Ribosome Brite KEGG Orthology (KO) [BR:mek00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MSKOL_3214   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MSKOL_3214  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mek03011]     MSKOL_3214    04121 Ubiquitin system [BR:mek04121]     MSKOL_3214 Ribosome [BR:mek03011]  Ribosomal proteins   Eukaryotes    Large subunit     MSKOL_3214   Archaea     MSKOL_3214 Ubiquitin system [BR:mek04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MSKOL_3214 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e Zn_Ribbon_1 DZR DZR_2 zf-AtTam37 Zn_ribbon_RPAB4 Zn_ribbon_ZPR1 Cas12f1-like_TNB Ribosomal_L37e zf-ChsH2 Zn_ribbon_LapB Zn_ribbon_3 Motif Other DBs NCBI-ProteinID:  AKB48991 UniProt:  A0A0E3LK67 LinkDB All DBs Position complement(4167608..4167757) Genome browser AA seq 49 aa AA seqDB search MGRFPEAEERLLNKKICMRCNARNAIRATRCRKCGYSALRVKSKESKGA NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atgggtcgttttccagaagcagaagaaagattattaaataaaaaaatttgcatgcgatgc aatgcaaggaatgcaataagggcaacccgctgcagaaaatgcggctacagtgctcttcgg gtaaaatccaaggaatccaagggagcatga

DBGET integrated database retrieval system