KEGG   Metabacillus sp. KUDC1714: HUW50_13550
Entry
HUW50_13550       CDS       T06752                                 
Name
(GenBank) BMP family ABC transporter substrate-binding protein
  KO
K05519  transcriptional activator of comK gene
Organism
meku  Metabacillus sp. KUDC1714
Brite
KEGG Orthology (KO) [BR:meku00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:meku03000]
    HUW50_13550
Transcription factors [BR:meku03000]
 Prokaryotic type
  Other transcription factors
   Others
    HUW50_13550
SSDB
Motif
Pfam: Bmp Peripla_BP_4
Other DBs
NCBI-ProteinID: QNF28409
UniProt: A0A7G7FU25
LinkDB
Position
2840802..2841755
AA seq 317 aa
MYKKLGLVLILLFSLFGCGQPTAQGKLQKVGLLVPETIDDQVWGTKGYMGLLKIQSELKV
DVFYKEGVNNESKIRAAIDEFKQNDVNLVFGHGSEYANFFNTISSEYPDIHFVLFNGKAD
GKNVTSLNFKSNAMGFFGGMVAGEMSKSDKVGVLAAFEWQPEVDGFFEGAYYQNENVHVE
IQYVQDWNDTSIAIPLLNEMIKNGVDIVYVAGDGYNVSVIERLKEEGLYAIGFVSDQSDL
GKGTVLTSTVQHVDVLYEVVANSFNKGELESGELFFDFQDGVISLGKFSPLVDKEFQASL
KDQIEEYKKTGLLPNQL
NT seq 954 nt   +upstreamnt  +downstreamnt
atgtacaaaaagctcggtcttgtccttattttacttttttcgcttttcggttgtggacaa
cctacagcacaagggaaacttcaaaaggtaggtctgcttgtacctgaaaccattgatgat
caagtttggggaacgaagggctatatgggccttcttaaaattcaatctgagctaaaggtt
gatgtattttataaagaaggagtgaataatgagagcaaaattcgtgctgcaattgatgaa
tttaagcaaaatgatgtgaatcttgtcttcggtcatggaagtgaatatgctaactttttt
aatacgatcagtagtgaatatcctgacatccatttcgtgctatttaatgggaaagctgac
ggaaaaaatgttacgagcttaaattttaagtcaaatgcaatggggttttttggtggtatg
gttgcaggggaaatgtcaaagtctgataaagttggtgttttagcggcctttgagtggcaa
cctgaggtagatggcttttttgaaggagcctattatcaaaatgaaaatgtccatgtagaa
attcaatatgtgcaagactggaatgatacatcgattgctattccacttcttaatgaaatg
atcaaaaatggtgttgacatcgtgtatgtagctggagatggatataatgtttcagtcatt
gaaagactaaaagaggaaggcttgtacgcaattggttttgtatccgaccaatctgattta
ggaaaaggtacggtgttaacaagtaccgttcaacatgttgatgtcttatatgaggttgta
gcaaattcctttaataaaggtgagcttgaaagtggagaattattttttgattttcaggac
ggcgtgatttctctagggaagtttagtcctcttgtagacaaagaatttcaagcatcgctt
aaagaccaaatcgaagaatataaaaaaactggactactgccaaatcaattataa

DBGET integrated database retrieval system