Melaminivora suipulveris: C6568_11325
Help
Entry
C6568_11325 CDS
T05358
Name
(GenBank) hypothetical protein
KO
K16345
xanthine permease XanP
Organism
mela
Melaminivora suipulveris
Brite
KEGG Orthology (KO) [BR:
mela00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
mela02000
]
C6568_11325
Transporters [BR:
mela02000
]
Other transporters
Electrochemical potential-driven transporters [TC:
2
]
C6568_11325
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Xan_ur_permease
Motif
Other DBs
NCBI-ProteinID:
AVO49779
UniProt:
A0A2R3QDC3
LinkDB
All DBs
Position
complement(2399504..2401318)
Genome browser
AA seq
604 aa
AA seq
DB search
MRAAAMIARRFFRLFVASTMRFFPLRLPATAARRRPPELAYAAGERPPAASLLLLAAQHA
GTTMAFIAYVLVAARLAGLDRLGTQAMVAMTLLGMALCTALQAWGGRVGSGALLVHMPNP
FMIPFVAALVAAHGPGGVASAALVYGVVALGMAPLVRHLRPLFPPTVVGVVICMGGMALV
STSVRQMLNVGAGQWQVDGASALVGGATLAAIVLLSVWGGRRLRLMALLAAMALGVLIAA
ALGRLEGGQALAGVPLVDLPRISRPVIRLDAGMLVALCLVAVLSHLDTLGSVIMLDKMDN
ADWKRADMQAIAGGIKANGIGDLVVGMLGAFPTATCSANIALAYATRSTARVIGLATAAL
LALVAFLPQLTLALTLIPEPVLGAVGLYAAGFLIVSGMELIVSRAMDSRTIFAVGLSLAA
GVALMEMPQLAQQLPEGLRFLLGNPFVVTGILVIALNLLFRLGTAQRASAALDAASPALH
ADIVSFVEARGAAWGARRSAVQVAALAAVEAAEAIAGGGRHVTGIRGSFDEFNLDLELLH
SGAPLPLAGAQAAPPVAADLLEGDDGALDAALAQVSGRLLHHLADRVGSGETDGQSWLRL
HFQH
NT seq
1815 nt
NT seq
+upstream
nt +downstream
nt
atgcgagcggccgcgatgatagcgcggcgtttttttcgcctcttcgtcgcctccaccatg
cgcttttttcccctgcgcctgccggccaccgccgcgcgccgccgcccgcccgagctcgcc
tacgccgcaggcgaacgcccacccgccgccagcctgctgctgctggccgcacaacacgcc
ggcacgaccatggccttcatcgcctacgtgctggtggccgcgcgcctggccgggctggac
cgcctgggcacgcaggccatggtggccatgacgctgctgggcatggcgctgtgcacggcg
ctgcaggcatggggcgggcgcgtgggcagcggcgcgctgctggtgcacatgcccaaccct
ttcatgattcccttcgtggccgcgctggtggcggcccacgggccgggcggcgtggccagc
gcggcgctggtctatggcgtggtggcgctgggcatggcgccgctggtgcgccatctgcgg
ccgctgtttccgcccaccgtggtgggcgtggtgatctgcatgggcggcatggcgctggtg
tcgacgtcggtgcggcagatgctgaacgtgggcgccgggcagtggcaggtcgacggcgcc
agcgccctggtgggcggcgcgacgctggccgccatcgtgctgctgtcggtctggggcggg
cgcaggctgcggctgatggcgctgctggcggccatggcgctgggcgtgctgatcgcggcc
gcgctgggccggctggagggcggacaggcgctggccggcgtgccgctggtcgatctgccg
cgcatcagccgcccggtgatccgcctggacgcgggcatgctggtggcgctgtgcctggtg
gcggtgctgtcgcacctggacacgctgggcagcgtgatcatgctggacaagatggacaac
gccgactggaagcgcgccgacatgcaggccatcgccggcggcatcaaggccaacggcatc
ggcgacctggtcgtgggcatgctgggagcctttcccaccgccacctgctcggccaacatc
gcgctggcctacgccacgcgctcgacggcgcgcgtcatcggcctggccaccgccgccctg
ctggcgctggtggccttcctgccgcagttgaccctggcgctgacgctgatccccgagccg
gtgctgggcgcggtggggctgtacgcggcgggcttcctgatcgtctcgggcatggagctg
atcgtctctcgcgccatggacagccgcaccatcttcgccgtcggcctgtcgctggccgcc
ggcgtggcgctgatggagatgccgcaactggcgcagcagctgcccgaaggcctgcgcttc
ctgctgggcaaccccttcgtggtcaccggcatcctggtcatcgcgctgaacctgctgttc
cgcctgggcacggcgcagcgcgccagcgccgcgctggacgccgccagccccgcgctgcac
gccgacatcgtctccttcgtcgaggcgcgcggtgccgcctggggcgcgcggcgcagcgcc
gtgcaggtggcggcgctggcggccgtggaggcggccgaggccatcgccggcggcggtcgg
catgtgacgggcatacgcggcagcttcgacgaattcaacctggacctggaactgctgcac
agcggcgcgccactaccactggcaggcgcccaggcggcgccgccagtggcggcagacctg
ctggagggcgacgatggcgccctggacgcggcgctggcccaggtttccggccggctgctg
caccatctggccgatcgcgtgggcagcggcgagaccgacgggcaatcctggctgcgcctg
catttccaacattga
DBGET
integrated database retrieval system