Methylomonas sp. LL1: IVG45_02495 Help Entry IVG45_02495       CDS       T07814                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism mell  Methylomonas sp. LL1 Brite KEGG Orthology (KO) [BR:mell00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:mell03110]     IVG45_02495 (grxC) Chaperones and folding catalysts [BR:mell03110]  Protein folding catalysts   Protein disulfide isomerase    IVG45_02495 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 SH3BGR Glrx-like Zn_ribbon_tTFIIB Motif Other DBs NCBI-ProteinID:  QPK63867 UniProt:  A0A7T0JNZ3 LinkDB All DBs Position complement(428025..428279) Genome browser AA seq 84 aa AA seqDB search MPEIIIYTGRLCPYCTMAKRLLDRKGATYTEIDVDSAPGLRQELMEKSKRRTIPQIYIGD RHIGGFDDLQALDMKKELDPLLLA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgccagaaatcatcatttataccggccggctgtgcccttactgcaccatggccaaaaga ctgctcgaccgcaaaggcgcgacttataccgaaatcgatgtcgattcggcgcccggcctt cgtcaagagttgatggaaaagtccaaacgccgcaccattccgcagatttacattggtgac cgccacattggcggctttgacgatctacaagcactggacatgaaaaaggaactggatccc ttgctgttggcctga

DBGET integrated database retrieval system