Methylomonas sp. LL1: IVG45_04465 Help Entry IVG45_04465       CDS       T07814                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mell  Methylomonas sp. LL1 Pathway mell01100   Metabolic pathways mell01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mell00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     IVG45_04465    00074 Mycolic acid biosynthesis     IVG45_04465   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     IVG45_04465 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF4047 Motif Other DBs NCBI-ProteinID:  QPK64229 UniProt:  A0A7T0NY25 LinkDB All DBs Position complement(860362..860619) Genome browser AA seq 85 aa AA seqDB search MSQTEIELKQLIIDTLALEEVNVDDIKSDAALFNSGLGLDSIDALELGLAIRKKYDVKID VEHDDVVKIFASVSALAQFIESVRQ NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgagtcagactgaaatcgaattaaaacagctgatcatcgacactctggcactggaagag gtgaacgtcgacgatatcaagtccgacgccgcgctgtttaatagcggcctgggattggat tcgatcgacgcactggagttgggcttggcaatcaggaagaaatacgacgtcaaaatcgac gtcgaacacgatgacgtggttaagatctttgcttcggtatccgcattggctcaattcata gaatccgtccgccaataa

DBGET integrated database retrieval system