Methylomonas sp. LL1: IVG45_11785 Help Entry IVG45_11785       CDS       T07814                                  Name (GenBank) TIGR02449 family protein   KO K09892   cell division protein ZapB Organism mell  Methylomonas sp. LL1 Brite KEGG Orthology (KO) [BR:mell00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mell03036]     IVG45_11785 Chromosome and associated proteins [BR:mell03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     IVG45_11785 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB Taxilin COG3_N DUF7491 DUF7018 NRBF2 HAUS-augmin3 Cep57_CLD_2 CATRA-C YabA ADIP DUF3450 HALZ ATP-synt_D Seryl_tRNA_N DUF2203 FapA Motif Other DBs NCBI-ProteinID:  QPK61574 UniProt:  A0A7T0NVJ0 LinkDB All DBs Position 2537311..2537538 Genome browser AA seq 75 aa AA seqDB search MSQSEKDPSTELTALEEKLDTLIAQYNQIQSENKSLKVKQDALVKEKAKLLEKTTQAKAR VEAMIARLKAMEHDS NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgtcccaatcagaaaaagacccatcaaccgaattgacagcgctggaagagaaactggac acgctgattgcgcaatacaaccagattcaaagcgaaaacaaatcgctaaaagttaaacaa gatgcactggtaaaagaaaaagccaaactattggaaaaaaccacccaggccaaagcgcgc gttgaagcgatgattgcccgcctgaaagcaatggaacacgattcatga

DBGET integrated database retrieval system