Methylomonas sp. LL1: IVG45_14605
Help
Entry
IVG45_14605 CDS
T07814
Symbol
lptF
Name
(GenBank) LPS export ABC transporter permease LptF
KO
K07091
lipopolysaccharide export system permease protein
Organism
mell
Methylomonas sp. LL1
Pathway
mell02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
mell00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
IVG45_14605 (lptF)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
mell02000
]
IVG45_14605 (lptF)
Transporters [BR:
mell02000
]
ABC transporters, prokaryotic type
ABC-2 type and other transporters
Lipopolysaccharide transporter
IVG45_14605 (lptF)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
LptF_LptG
LiaI-LiaF-like_TM1
Motif
Other DBs
NCBI-ProteinID:
QPK62085
LinkDB
All DBs
Position
complement(3153051..3154187)
Genome browser
AA seq
378 aa
AA seq
DB search
MSIDRAIPGASRPFRLLTVLDKMIIKDLFKTVVSVLTVLVVIIVSRKFIKVLAQAIEGNI
ASETVLALLGLKIVIAATTFLPASLFMAVLMVLGRMHREQEIAAIASAGGGVSTIYRAVF
WLVVPLSVCASGLSMVAAPWAEAQTELLMHQDRENSDIRGISAGRFSEYSSGELIFYTEN
VDVNGRMHNVFVQNKQGDKLGVVNAEFGKLEYLPGGLYLILEQGERVQGIPGQKDYTIET
FREYAVLVEKKAIAFVPRIEALPTEKIWKSTTVTEIALMQDRLNVPLGVLILAFLAVPLA
KSSPRGGVYGSVLIAFGIYFSYGNLQRINHSWVVSGIVPSWLGYFWVEALLLIVGLFMLV
RLYSWKWVALKLTGKVTV
NT seq
1137 nt
NT seq
+upstream
nt +downstream
nt
ttgagcatagatcgagcaatccccggcgctagcaggcctttccggctgttgacggtgttg
gacaaaatgatcattaaggacctgtttaaaaccgtcgtgtcggttctgaccgtgctggtg
gtaatcatcgtcagccgcaaattcattaaagtcttggcgcaggcgattgaaggcaatatc
gccagtgaaaccgtgctggcgctacttggattgaaaatcgtgattgccgctaccaccttt
ttgccggcctcattgttcatggcggtcttaatggtgctgggacgcatgcatagagagcag
gaaatcgcggcgatcgcctcggcgggaggcggtgtatccaccatttatcgcgcggtattc
tggctggtggtgcctctaagcgtctgtgcttcgggtttatcgatggttgccgcgccatgg
gcggaagcgcaaaccgaattgctgatgcatcaggatagggaaaattccgatatccgcggt
atttccgccggccgttttagcgaatatagcagtggcgaattgattttttataccgaaaat
gtcgatgtcaacggtcgaatgcataatgtgtttgtccaaaacaaacaaggcgataagctg
ggcgtggtgaatgccgagttcggcaaactggagtacttgcccggcggcttgtatttgatt
ctggagcagggcgagcgcgttcaaggcatacccggccaaaaagattacaccatcgaaact
tttagggaatatgcggtattggtggagaaaaaagccatcgcttttgtgccgcgtatcgaa
gccttgccgaccgaaaaaatctggaaatcgactaccgttaccgagattgccctgatgcag
gacagattgaatgtgccgttgggcgtgctaattttggcatttctggcggtaccgttggcc
aaatcctcgcctcgcggcggcgtttacggcagcgtattgatcgcattcgggatttatttt
tcctacggaaatttacagcgtatcaaccatagctgggtcgtcagcggcattgtgccgagt
tggctgggttatttttgggtggaagccttgttgctcatcgttggtttattcatgctggta
cgtttatacagctggaaatgggtggcacttaaattgaccggcaaggtgacggtatga
DBGET
integrated database retrieval system