Methylomonas sp. LL1: IVG45_19205 Help Entry IVG45_19205       CDS       T07814                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mell  Methylomonas sp. LL1 Pathway mell01100   Metabolic pathways mell01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mell00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     IVG45_19205    00074 Mycolic acid biosynthesis     IVG45_19205   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     IVG45_19205 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QPK62927 LinkDB All DBs Position complement(4103825..4104088) Genome browser AA seq 87 aa AA seqDB search MSDDLISQLKTMLIEGLRLEDIVPDDLSPDAALFGGGLGLDSIDALEIGVMLDRQYGIKI TSGDERNNQIFVSLRSLADFVATHRTR NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgtcagatgacttgatcagccaattgaaaaccatgctcatcgaaggtttgcgccttgag gacatcgtgcccgacgacctttctcccgatgcggctctatttggcggagggctgggattg gattccattgacgcgctggaaataggcgtgatgctggatcgccagtacggcatcaagatc acttccggcgacgaacgcaacaaccagattttcgtctctctcaggtcgctggccgacttt gtcgcgacccatcgcacccgctaa

DBGET integrated database retrieval system