Methanococcoides orientis: J7W08_00195 Help Entry J7W08_00195       CDS       T08012                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism melo  Methanococcoides orientis Pathway melo03010   Ribosome Brite KEGG Orthology (KO) [BR:melo00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     J7W08_00195   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     J7W08_00195  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:melo03011]     J7W08_00195    04121 Ubiquitin system [BR:melo04121]     J7W08_00195   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:melo04147]     J7W08_00195 Ribosome [BR:melo03011]  Ribosomal proteins   Eukaryotes    Small subunit     J7W08_00195   Archaea     J7W08_00195 Ubiquitin system [BR:melo04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    J7W08_00195 Exosome [BR:melo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    J7W08_00195   Exosomal proteins of colorectal cancer cells    J7W08_00195 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Ribosomal_L37e Zn_ribbon_Nudix Zn_ribbon_RPB9 Zn_Ribbon_1 IBR Zn_ribbon_IS1595 MqsA_antitoxin IBR_1 Zn_Ribbon_TF DUF1451 Zn_ribbon_NUD Cas12f1-like_TNB Zn_ribbon_11 DZR Zn_ribbon_NOB1 DUF6671 Zn_ribbon_13 Zn_ribbon_19 Motif Other DBs NCBI-ProteinID:  UGV40810 LinkDB All DBs Position 44825..44974 Genome browser AA seq 49 aa AA seqDB search MAVKDYYKVTGDSIERLRQFCPRCGDGVYLADHKDRLTCGKCGYTEFKK NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggcagttaaagactactacaaagtaaccggcgattccatcgaaagactgaggcagttc tgcccacgctgcggcgatggtgtatatcttgcagaccacaaggacagacttacctgtggt aaatgcggatacactgaattcaagaaataa

DBGET integrated database retrieval system