Candidatus Methanoliparum sp. LAM-1: MTLP_05930 Help Entry MTLP_05930        CDS       T07692                                  Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism melu  Candidatus Methanoliparum sp. LAM-1 Pathway melu03010   Ribosome Brite KEGG Orthology (KO) [BR:melu00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MTLP_05930   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MTLP_05930  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:melu03011]     MTLP_05930    04121 Ubiquitin system [BR:melu04121]     MTLP_05930 Ribosome [BR:melu03011]  Ribosomal proteins   Eukaryotes    Large subunit     MTLP_05930   Archaea     MTLP_05930 Ubiquitin system [BR:melu04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MTLP_05930 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Zn_Ribbon_1 Ribosomal_L40e DZR DZR_2 Zn_ribbon_RPAB4 UPF0547 Zn_ribbon_IFT122 Ribosomal_L37e DHHC Motif Other DBs NCBI-ProteinID:  BDC35911 LinkDB All DBs Position complement(537307..537453) Genome browser AA seq 48 aa AA seqDB search MVRFPEADARLFNKKICMRCNANNPLKAKRCRKCGYDKLRKKSKERRA NT seq 147 nt NT seq  +upstreamnt  +downstreamnt atggtacggtttcctgaagcagatgcgaggctattcaataaaaaaatttgtatgagatgc aatgcaaataatccactaaaagcaaaacgatgcagaaagtgtggatacgataaactgaga aagaagtctaaagaaagaagagcttag

DBGET integrated database retrieval system