KEGG   Methanoculleus marisnigri: Memar_1857
Entry
Memar_1857        CDS       T00477                                 
Name
(GenBank) conserved hypothetical protein
  KO
K06934  uncharacterized protein
Organism
mem  Methanoculleus marisnigri
Brite
KEGG Orthology (KO) [BR:mem00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Memar_1857
SSDB
Motif
Pfam: PCC
Other DBs
NCBI-ProteinID: ABN57783
UniProt: A3CWN3
LinkDB
Position
1851652..1852101
AA seq 149 aa
MQYSEGQVGRVFTVRIDDGEDFLREIQRFVTAMNIRCGTIQFLGAVRSATIVTGPKEPVI
PPAPRGEEIFGGWELVGFATIYPGEDGPSIHLHTAAGKGIRSLAGCLREKAEVYLVIEAI
VTEFVGITAKRLPDEKTGVNLPVFDRTLP
NT seq 450 nt   +upstreamnt  +downstreamnt
atgcagtactcggaaggacaggtcggcagggtcttcaccgtccggatcgacgacggggag
gactttcttcgggagatccagcggttcgtcacggcgatgaacatcaggtgcggcacgatc
cagttcctcggcgccgtccggtcggcaacgatcgtgacggggccgaaagagccggtcatc
ccgccggcaccgcggggcgaagagatattcgggggctgggaactcgtcgggttcgcgacc
atctaccccggggaggacgggccgtccatccacctccatacggcggcagggaaggggata
cggtcgcttgccgggtgcctccgggagaaggcggaggtctacctggtgatcgaagcgatc
gtcacggagttcgtcggcatcaccgcaaaacggctccccgacgagaagaccggcgtcaac
ctcccggtcttcgaccggacgctcccatga

DBGET integrated database retrieval system