Methanoculleus marisnigri: Memar_2246 Help Entry Memar_2246        CDS       T00477                                  Name (GenBank) SSU ribosomal protein S27AE   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mem  Methanoculleus marisnigri Pathway mem03010   Ribosome Brite KEGG Orthology (KO) [BR:mem00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Memar_2246   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Memar_2246  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mem03011]     Memar_2246    04121 Ubiquitin system [BR:mem04121]     Memar_2246   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mem04147]     Memar_2246 Ribosome [BR:mem03011]  Ribosomal proteins   Eukaryotes    Small subunit     Memar_2246   Archaea     Memar_2246 Ubiquitin system [BR:mem04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Memar_2246 Exosome [BR:mem04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Memar_2246   Exosomal proteins of colorectal cancer cells    Memar_2246 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Auto_anti-p27 MqsA_antitoxin Rcat_RNF216 Zn_ribbon_NOB1 Zn_ribbon_Nudix Zn_ribbon_RPB9 DUF1451 Ribosomal_L37e DUF1936 Zn_ribbon_13 Cas12f1-like_TNB Motif Other DBs NCBI-ProteinID:  ABN58169 UniProt:  A3CXR9 LinkDB All DBs Position 2237153..2237308 Genome browser AA seq 51 aa AA seqDB search MAVKRHECYEVKGDTAVLQKRHCPRCGPGVLMAAHKDRVACGKCGYTEFQK NT seq 156 nt NT seq  +upstreamnt  +downstreamnt atggcggtcaagagacacgagtgctatgaagtcaagggcgatacggcagttctgcagaag cggcactgtccccggtgcggccccggcgtgctgatggccgcgcacaaggaccgggtagcc tgcggcaagtgcggctacactgaattccagaagtag

DBGET integrated database retrieval system